Clone BO20859 Report

Search the DGRC for BO20859

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:208
Well:59
Vector:pDNR-Dual
Associated Gene/TranscriptZasp52-RE
Protein status:BO20859.pep: Imported from assembly
Sequenced Size:2374

Clone Sequence Records

BO20859.complete Sequence

2374 bp assembled on 2010-10-20

GenBank Submission: KX794359

> BO20859.complete
GAAGTTATCAGTCGACATGGCCCAACCACAGCTGCTGCAAATCAAATTGT
CACGTTTCGATGCCCAACCCTGGGGATTCCGCCTTCAGGGGGGCACGGAC
TTCGCTCAGCCCCTGCTGGTGCAAAAGGTGAACGCCGGCAGCTTGTCCGA
GCAGGCTGGCCTCCAGCCCGGCGATGCGGTGGTCAAGATCAATGACGTGG
ATGTCTTCAATCTGCGTCACAAGGATGCCCAGGACATTGTGGTGCGCTCC
GGCAACAACTTTGTCATCACAGTGCAGCGCGGTGGCTCCACCTGGCGCCC
GCATGTGACACCGACTGGCAATGTGCCGCAGCCCAACTCGCCGTATCTGC
AGACGGTGACGAAGACCTCTCTGGCTCACAAACAACAGGACAGCCAGCAC
ATCGGCTGTGGCTACAACAACGCGGCCCGTCCCTTCTCCAACGGCGGCGA
TGGCGGCGTGAAGAGCATTGTCAATAAACAATACAACACCCCGGTTGGCA
TTTACAGCGATGAATCTATTGCGGAAACACTCTCGGCCCAGGCGGAGGTT
TTGGCTGGCGGTGTGCTCGGCGTCAACTTCAAGAAGAACGAGAAGGAATA
CCAGGGCGATCGCTCCGAGGTTCTGAAGTTCCTGCGCGAGGAGGAGACCG
GCCAGTCCACTCCAGAACCACACAGTCCCGCCAACTTCTACTGGACACAG
AGCCACGCAATCGGCGGCAACGAGCGACGCACTCCACTGCACCACCAGCA
CCAGCAGCCTCAGCAGGATGAGCGGATTGGTGTACCATTGCAGTCAAATA
CACTGGCGCCGGAGGCGACACACAGGCCCAGCTTGCCGGTGGCCCCGAAG
GATAACGAGGAGCAGGCCAGACAGGATCAGCAGGAGCAGCCCGATCCGCG
CATCATTGTGCTGCCCATCTGCCCCGGCCTCCAGGGGCCCGAGTATAAGG
CTGAAATGGAGGCTGCAGCCGCGGCACTGGCCACCGACCAGGATGGACGA
CCACGTCCATTGGCCGCCAGCGGACATCCGGCCTGCCAGCTGTGCGGCGT
GGGCATTGTTGGCGTTTTCGTGCGCATCAAGGATAAGAACCTGCACGTGG
AGTGCTTCAAGTGTGCCACGTGTGGCACCTCGCTGAAGAACCAGGGCTAC
TACAACTTCAACAACAAGCTCTACTGCGACATCCACGCCAAACAGGCCGC
CATCAACAATCCCCCCACCGGCACCGAGGGCTACGTCCCCGTTCCCATCA
AGCCCAACACCAAGCTGAGTGCCTCCACCATCTCATCGGCCTTGAACTCG
CACGGATACGGTGGCCACTCGAACGGCTACTCCAATGGAAACTCCACCCC
TGCTCCGGCACCGGTGAACCAGGGCTATGCTCGTCCGTTCGGTGCCGCCG
CTCCCAAGTCGCCGGTGTCGTATCCGCCGCAGCAGCAACAGCAGTCGCCG
CGTCCCGCTCCCGGTGGCCAAAACCCGTACGCCACCCTGCCCCGCAGCAA
TGTGGGCCAACAAGGTCGTAATGTAAGGTACCAACAACAGCAACAACAGC
AGCAGCAATACAACAATCAGCAGAAGCAGCAGTATAGGAACTCTTACCCC
ATGGGATCTAATTATAGCACCCCGAGTCAGTCCCCCTACATCACCTCCAA
CACCAACAACTATAGCAGCAGCAACAGCTACAATAACAACAACTATAGCA
ACTACAACAATAATAATGTGTACCGAGGTGCCGGAGGAAAGAGCGCTGGC
GCCTTTGGAGCCACCTCGGCGCCCAAGAGGGGCAGGGGTATCCTGAATAA
GGCAGCCGGACCCGGAGTGCGCATCCCACTGTGCAACAGCTGCAATGTGC
AGATCAGAGGACCCTTTATCACGGCATTGGGCCGCATCTGGTGCCCGGAT
CATTTCATCTGCGTGAACGGCAACTGCCGTCGTCCGCTGCAGGACATTGG
ATTCGTTGAGGAGAAGGGCGATCTGTACTGCGAGTACTGTTTCGAGAAGT
ACCTGGCGCCCACTTGCAGCAAGTGCGCTGGCAAGATCAAGGGTGACTGT
TTGAATGCCATTGGCAAACACTTCCATCCGGAGTGCTTCACCTGCGGCCA
GTGCGGCAAGATCTTTGGCAACAGGCCCTTCTTCCTGGAGGATGGAAACG
CGTACTGCGAGGCCGATTGGAACGAGTTGTTCACCACCAAGTGCTTCGCC
TGCGGCTTCCCCGTGGAAGCTGGCGACAGATGGGTGGAGGCCTTGAACCA
CAACTACCATAGCCAATGCTTCAACTGCACGTTCTGCAAACAGAACCTGG
AGGGTCAGAGCTTCTACAACAAGGGCGGACGTCCCTTCTGCAAGAATCAC
GCGCGCGCAAGCTTTCTAGACCAT

BO20859.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp52-RE 2343 CG30084-PE 1..2340 17..2356 11700 100 Plus
Zasp52-RN 3804 CG30084-PN 1..1711 17..1727 8555 100 Plus
Zasp52-RO 1548 CG30084-PO 1..1500 17..1516 7500 100 Plus
Zasp52-RN 3804 CG30084-PN 3171..3801 1726..2356 3155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp52-RE 3176 CG30084-RE 206..2545 17..2356 11700 100 Plus
Zasp52-RN 4637 CG37-RN 206..1916 17..1727 8555 100 Plus
Zasp52-RO 1963 CG37-RO 206..1705 17..1516 7500 100 Plus
Zasp52-RN 4637 CG37-RN 3376..4006 1726..2356 3155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15779265..15779661 1059..663 1985 100 Minus
2R 25286936 2R 15763350..15763591 2281..2040 1210 100 Minus
2R 25286936 2R 15773039..15773255 1729..1513 1085 100 Minus
2R 25286936 2R 15778352..15778546 1254..1060 975 100 Minus
2R 25286936 2R 15763645..15763832 2042..1855 940 100 Minus
2R 25286936 2R 15783088..15783245 436..279 790 100 Minus
2R 25286936 2R 15773814..15773967 1516..1363 770 100 Minus
2R 25286936 2R 15783315..15783468 279..126 770 100 Minus
2R 25286936 2R 15781773..15781906 570..437 670 100 Minus
2R 25286936 2R 15765123..15765254 1857..1726 660 100 Minus
2R 25286936 2R 15803359..15803471 129..17 565 100 Minus
2R 25286936 2R 15777176..15777286 1365..1255 555 100 Minus
2R 25286936 2R 15780985..15781080 665..570 480 100 Minus
2R 25286936 2R 15763196..15763271 2356..2281 380 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:11:24 has no hits.

BO20859.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:49 Download gff for BO20859.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp-RE 202..2541 17..2358 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:42 Download gff for BO20859.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp52-RE 206..2545 17..2358 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:10 Download gff for BO20859.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp52-RE 206..2545 17..2358 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:10 Download gff for BO20859.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15803361..15803471 17..127 100   Minus
2R 15783315..15783466 128..279 100 <- Minus
2R 15783088..15783244 280..436 100 <- Minus
2R 15781773..15781906 437..570 100 <- Minus
2R 15780985..15781079 571..665 100 <- Minus
2R 15779265..15779658 666..1059 100 <- Minus
2R 15778352..15778546 1060..1254 100 <- Minus
2R 15777178..15777286 1255..1363 100 <- Minus
2R 15773816..15773966 1364..1514 100 <- Minus
2R 15773041..15773253 1515..1727 100 <- Minus
2R 15765123..15765252 1728..1857 100 <- Minus
2R 15763646..15763829 1858..2041 100 <- Minus
2R 15763350..15763589 2042..2281 100 <- Minus
2R 15763194..15763270 2282..2358 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:42 Download gff for BO20859.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11690866..11690976 17..127 100   Minus
arm_2R 11670820..11670971 128..279 100 <- Minus
arm_2R 11670593..11670749 280..436 100 <- Minus
arm_2R 11669278..11669411 437..570 100 <- Minus
arm_2R 11668490..11668584 571..665 100 <- Minus
arm_2R 11666770..11667163 666..1059 100 <- Minus
arm_2R 11665857..11666051 1060..1254 100 <- Minus
arm_2R 11664683..11664791 1255..1363 100 <- Minus
arm_2R 11661321..11661471 1364..1514 100 <- Minus
arm_2R 11660546..11660758 1515..1727 100 <- Minus
arm_2R 11652628..11652757 1728..1857 100 <- Minus
arm_2R 11651151..11651334 1858..2041 100 <- Minus
arm_2R 11650855..11651094 2042..2281 100 <- Minus
arm_2R 11650699..11650775 2282..2358 97 <- Minus

BO20859.pep Sequence

Translation from 16 to 2374

> BO20859.pep
MAQPQLLQIKLSRFDAQPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQ
PGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQRGGSTWRPHVTPT
GNVPQPNSPYLQTVTKTSLAHKQQDSQHIGCGYNNAARPFSNGGDGGVKS
IVNKQYNTPVGIYSDESIAETLSAQAEVLAGGVLGVNFKKNEKEYQGDRS
EVLKFLREEETGQSTPEPHSPANFYWTQSHAIGGNERRTPLHHQHQQPQQ
DERIGVPLQSNTLAPEATHRPSLPVAPKDNEEQARQDQQEQPDPRIIVLP
ICPGLQGPEYKAEMEAAAAALATDQDGRPRPLAASGHPACQLCGVGIVGV
FVRIKDKNLHVECFKCATCGTSLKNQGYYNFNNKLYCDIHAKQAAINNPP
TGTEGYVPVPIKPNTKLSASTISSALNSHGYGGHSNGYSNGNSTPAPAPV
NQGYARPFGAAAPKSPVSYPPQQQQQSPRPAPGGQNPYATLPRSNVGQQG
RNVRYQQQQQQQQQYNNQQKQQYRNSYPMGSNYSTPSQSPYITSNTNNYS
SSNSYNNNNYSNYNNNNVYRGAGGKSAGAFGATSAPKRGRGILNKAAGPG
VRIPLCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEK
GDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIF
GNRPFFLEDGNAYCEADWNELFTTKCFACGFPVEAGDRWVEALNHNYHSQ
CFNCTFCKQNLEGQSFYNKGGRPFCKNHARASFLDH

BO20859.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp52-PE 780 CG30084-PE 1..780 1..780 4271 100 Plus
Zasp52-PG 890 CG30084-PG 1..890 1..780 3623 79.4 Plus
Zasp52-PR 722 CG30084-PR 1..722 1..780 3538 85.5 Plus
Zasp52-PS 787 CG30084-PS 1..787 1..780 3309 76.7 Plus
Zasp52-PU 716 CG30084-PU 1..716 1..780 3101 76.5 Plus