Clone BO20887 Report

Search the DGRC for BO20887

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:208
Well:87
Vector:pDNR-Dual
Associated Gene/Transcriptmtt-RC
Protein status:BO20887.pep: Imported from assembly
Sequenced Size:2374

Clone Sequence Records

BO20887.complete Sequence

2374 bp assembled on 2010-10-20

GenBank Submission: KX794933

> BO20887.complete
GAAGTTATCAGTCGACATGCGGGCGGTGCGCCGGGCGAATGCAACTGGTT
CCTTCTCCTGGATCGGATCCGATGGCTGGAGTGCCCGGAATTTGGTGTCC
GACGACTACGAGCCGGAGGTGGAAGGCACGCTGTCTGTGCAGCCGCAGGC
GAATCCGGTGCGCGGGTTCGAGGAGTACTTCCTCAGTCTGACGGTGGAGA
ACAATCAACGCAATCCCTGGTTTGTGGAATTCTGGGAGGATCACTTTCAG
TGCCGATATCCCGGCAGTACGAGCACTCCGTACAATAACTACACCAAACA
GTGCACCACAAAGGAGCGACTTTCACGCCAGAACACTGACTTCGAGGACC
AGTTGCAGTTTGTCAGCGATGCGGTGATGGCATTTGCATACGCCCTAAGG
GATATGCACCGCGACCTGTGCGGCGGAGGTCCTTCTCTCTGCGAGGCCAT
GAAGCCAACGAAGGGTGCAGACTTGCTGAAATATTTGCGAAAAGTGGAGT
TTGAGGGCCTCAGCGGCGACGAGTTCCGCTTCGACGGGAACGGCGACGGT
CCCGCCCGGTACAACATCATCCACTTCAAGCAGTCCCAGGCGGGACAGTA
CCACTGGGTCAAGGTGGGCGAGTACACCGAGGGCGAGCTGCGGCTTAATA
TGACGGAGGTGAAGTTTAAGCGGCTGAGTCCCAAGCCGCCGGAGTCTGTC
TGCAGCCTGCCATGTCTTGTGGGTCAGGCCAAGAAGTACGTGGAAGGCGA
GAGCTGCTGTTGGCACTGCTTCAATTGCACAACCTATCAAATCCGCCACC
CGGATGACGAGACCCATTGCAAGCTGTGCAAGCTGGGCACTCTTCCCGAC
GCCCACAAGCAGTACTGCCGCCCCATCCCGGAGATATATTTGCGTCCGGA
GTCCGCTTGGGCCATCGGTGCTATGGCGTTCAGTGCGACCGGGATCTTAG
TAACGCTCTTCGTAATGGGCGTATTTGTCAGGCACAACGACACGCCCATA
GTGCGTGCCTCTGGTCGGGAGCTGAGCTACATCCTGCTGGCGGGGATTTT
CATGTGCTACGGTGTCACCTTTGCCCTGGTCCTGAAGCCGACCAACATAG
TGTGTGCCATTCAGCGGTTTGGTGTCGGCTTCTGCTTCACGGTCGTTTAT
GCAGCACTGTTGACCAAAACGAATCGCATTGCACGGATCTTCAAAGCGGG
CAAACAATCCGCCAAGAGGCCCTCCTTCATTAGTCCCAAGTCCCAGCTGG
TAATCTGTGCGTGCCTGGTTAGTGTGCAGATACTCATCAACGGCGTTTGG
ATGGTAATTGCGCCATCACATGCCATGCACCATTATCCCACACGCGAGGA
TAATCTGCTCGTCTGCGACTCGTACATCGACGCCTCCTACATGATTGCGT
TCTCCTACCCAATCTTCCTGATTGTTATTTGCACGGTCTACGCGGTGCTC
ACGCGAAAGATTCCGGAGGCTTTCAACGAATCGAAGCATATTGGATTCAC
CATGTACACGACTTGTGTGATTTGGCTGGCTTTTGTACCGCTCTACTTCG
GAACCGCCAACCACGTTCCGCTGCGCATCACCAGCATGTCGGTGACCATC
AGCTTATCCGCCAGCGTGACCATCGCCTGTCTCTTTTCGCCCAAGCTGTA
CATAATACTCATACGCCCCGAGCGCAACGTGCGCCAGAGTATGATGCCGC
CTCGCTACGGCAACATGCACCGCACCGCTGGCACAGGACCCTCGTCCATG
ATGGCCGCCGCCGTGGTGACCGCCGCCACCTGTGCCCAGGAGGAGAAGAT
CCAGAAGCATATCACTCCCACAAACACAGAAAACTCGCTAAAGACGAAGA
AATTGTGCGAAATGGCCACTCAGACAATTTCCAGTATAATCACGTCGCTG
GACATCAATGCGTACAATCAAATACCATATGCCGATCAATATGTGCCAAA
CAATGCCACAACGGCCACGACCACGCCCACAGATAAGGGCAGTGGCAACG
GCAACAGCAACAGCAATAGCAATACGAATGGTAGTAGCAATAGCAACAGC
AACAGCAATGGCGATGGCGATGTGGCAACAGAGCAAGTCGTGGCCAACAA
TAATAAAATCAATCAGCGACAACATGGCCAGCCGGCCGTGGCATTTGCCA
TCACATCGACTAACAATCACATAAGCGGCCCAGCAGCAACCATAACAACA
ACAGCGGCAACTGGCGAAACAACAACTGAGGCGCTGGTGGCTACAATAAC
AACTCCATTGGCAACGGTGGATGGCAGCGAAACCATGTCCGTGGCTCCCA
ACAATGGGCATGGAAACAACGGGAGCCAACGTCCGCCGGTCCTGCAAACA
AACTTAGCAAGCTTTCTAGACCAT

BO20887.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
mtt-RG 4419 CG30361-PG 1906..4245 17..2356 11685 100 Plus
mtt-RF 3747 CG30361-PF 1405..3744 17..2356 11685 100 Plus
mtt-RE 3288 CG30361-PE 946..3285 17..2356 11685 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
mtt-RG 7328 CG30361-RG 3527..5866 17..2356 11685 100 Plus
mtt-RF 5422 CG30361-RF 1621..3960 17..2356 11685 100 Plus
mtt-RE 6368 CG30361-RE 2567..4906 17..2356 11685 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8475418..8475947 2356..1827 2650 100 Minus
2R 25286936 2R 8479852..8480070 1494..1276 1095 100 Minus
2R 25286936 2R 8481216..8481407 982..791 960 100 Minus
2R 25286936 2R 8476476..8476661 1829..1644 930 100 Minus
2R 25286936 2R 8482855..8483028 400..227 870 100 Minus
2R 25286936 2R 8480181..8480344 1279..1116 820 100 Minus
2R 25286936 2R 8479324..8479476 1645..1493 765 100 Minus
2R 25286936 2R 8481948..8482098 656..506 755 100 Minus
2R 25286936 2R 8480423..8480562 1118..979 700 100 Minus
2R 25286936 2R 8481644..8481778 790..656 675 100 Minus
2R 25286936 2R 8483132..8483242 227..117 555 100 Minus
2R 25286936 2R 8482605..8482718 507..394 540 98.2 Minus
2R 25286936 2R 8483601..8483704 120..17 520 100 Minus
Blast to na_te.dros performed 2014-11-26 15:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2325..2411 2181..2267 147 63.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2379..2466 2181..2265 144 65.9 Plus
TART-A 13424 TART-A 13424bp 118..147 2180..2209 132 93.3 Plus
TART-A 13424 TART-A 13424bp 11296..11325 2180..2209 132 93.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..6878 2180..2336 130 56.2 Plus
accord2 7650 accord2 QBERT 7650bp 4354..4422 2108..2040 120 63.8 Minus

BO20887.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:52 Download gff for BO20887.complete
Subject Subject Range Query Range Percent Splice Strand
mXr-RE 2188..4527 17..2358 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:45 Download gff for BO20887.complete
Subject Subject Range Query Range Percent Splice Strand
mtt-RE 2567..4906 17..2358 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:08:24 Download gff for BO20887.complete
Subject Subject Range Query Range Percent Splice Strand
mtt-RE 2567..4906 17..2358 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:08:24 Download gff for BO20887.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8483603..8483704 17..118 100   Minus
2R 8483132..8483240 119..227 100 <- Minus
2R 8482856..8483027 228..399 100 <- Minus
2R 8482606..8482712 400..506 99 <- Minus
2R 8481948..8482097 507..656 100 <- Minus
2R 8481644..8481777 657..790 100 <- Minus
2R 8481217..8481407 791..981 100 <- Minus
2R 8480425..8480559 982..1116 100 <- Minus
2R 8480181..8480343 1117..1279 100 <- Minus
2R 8479853..8480066 1280..1493 100 <- Minus
2R 8479324..8479475 1494..1645 100 <- Minus
2R 8476476..8476659 1646..1829 100 <- Minus
2R 8475414..8475944 1830..2358 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:45 Download gff for BO20887.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4371108..4371209 17..118 100   Minus
arm_2R 4370637..4370745 119..227 100 <- Minus
arm_2R 4370361..4370532 228..399 100 <- Minus
arm_2R 4370111..4370217 400..506 99 <- Minus
arm_2R 4369453..4369602 507..656 100 <- Minus
arm_2R 4369149..4369282 657..790 100 <- Minus
arm_2R 4368722..4368912 791..981 100 <- Minus
arm_2R 4367930..4368064 982..1116 100 <- Minus
arm_2R 4367686..4367848 1117..1279 100 <- Minus
arm_2R 4367358..4367571 1280..1493 100 <- Minus
arm_2R 4366829..4366980 1494..1645 100 <- Minus
arm_2R 4363981..4364164 1646..1829 100 <- Minus
arm_2R 4362919..4363449 1830..2358 99 <- Minus

BO20887.pep Sequence

Translation from 16 to 2374

> BO20887.pep
MRAVRRANATGSFSWIGSDGWSARNLVSDDYEPEVEGTLSVQPQANPVRG
FEEYFLSLTVENNQRNPWFVEFWEDHFQCRYPGSTSTPYNNYTKQCTTKE
RLSRQNTDFEDQLQFVSDAVMAFAYALRDMHRDLCGGGPSLCEAMKPTKG
ADLLKYLRKVEFEGLSGDEFRFDGNGDGPARYNIIHFKQSQAGQYHWVKV
GEYTEGELRLNMTEVKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWH
CFNCTTYQIRHPDDETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAI
GAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGV
TFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAK
RPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVC
DSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTC
VIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIR
PERNVRQSMMPPRYGNMHRTAGTGPSSMMAAAVVTAATCAQEEKIQKHIT
PTNTENSLKTKKLCEMATQTISSIITSLDINAYNQIPYADQYVPNNATTA
TTTPTDKGSGNGNSNSNSNTNGSSNSNSNSNGDGDVATEQVVANNNKINQ
RQHGQPAVAFAITSTNNHISGPAATITTTAATGETTTEALVATITTPLAT
VDGSETMSVAPNNGHGNNGSQRPPVLQTNLASFLDH

BO20887.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
mtt-PG 1472 CG30361-PG 636..1415 1..780 4133 100 Plus
mtt-PF 1248 CG30361-PF 469..1248 1..780 4133 100 Plus
mtt-PE 1095 CG30361-PE 316..1095 1..780 4133 100 Plus
mtt-PD 1415 CG30361-PD 636..1415 1..780 4133 100 Plus
mtt-PC 780 CG30361-PC 1..780 1..780 4133 100 Plus