Clone BO20925 Report

Search the DGRC for BO20925

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:209
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptAnk2-RE
Protein status:BO20925.pep: Imported from assembly
Sequenced Size:2125

Clone Sequence Records

BO20925.complete Sequence

2125 bp assembled on 2010-10-20

GenBank Submission: KX795799

> BO20925.complete
GAAGTTATCAGTCGACATGGCCCAGTTTGTGACCCACATCCAGCCAACGC
TGATGGAGGCGTCCCAAGGTCATGTTCCTCACCACCACGGACATCAGGTG
GGTGTGCAGCACTCGTCGCATCTGCCCCACAGCGGCCACAACATGCCCTC
GCCGCCAACCCACAATCACCATCATGCCCACGGACATGGTCATCATACCA
GCAGCGGTGGTCATCATGGAGGAGCAGGTGGCCATTCACAGAAGCAGGCA
GCGCATCATAGCACCACCTCCGGCCACGCCGCCAAGGGACAGCACCACAG
CCCACCGTCGAGGATCCATTCACCGCCAACGGAACACCATCCGGATCATG
TCGGTCACTACGAGTACTTCCAGCATCAGCACGAGCAGATCTTCCACCAT
GAAGGAGCAAACGGTGGTGCCAGCCACAAGCAACAGACCCACCACCATCC
CAACAAGCACGAGCACTGCCCCACAGGACACCAGAGTGCGGGCGATGGAA
ACACTTCCTTCCTGCGTGCCGCTCGCGCCGGAAATCTGGAGCGAGTGCTC
GAGCATTTGAAGAACAACATTGACATTAACACCAGCAATGCGAATGGCTT
GAATGCCCTGCACCTGGCCTCCAAGGATGGCCACATCCACGTCGTCTCGG
AACTCCTTCGTAGGGGCGCGATTGTGGATAGTGCCACCAAAAAGGGAAAC
ACTGCCCTCCACATCGCCTCATTGGCTGGACAGGAGGAGGTGGTGAAGCT
ACTGCTGGAGCACAATGCCTCCGTAAATGTGCAATCCCAGAATGGATTCA
CTCCACTCTACATGGCTGCCCAGGAGAACCACGATGCTGTGGTGCGTCTC
CTTTTGTCCAACGGAGCCAACCAGAGTCTGGCCACCGAGGATGGCTTCAC
CCCACTGGCGGTGGCCATGCAGCAGGGTCATGACAAAGTCGTTGCTGTCC
TCCTCGAGAGTGATACTCGTGGAAAGGTCAGGCTTCCTGCGCTGCACATT
GCCGCCAAAAAGGACGACGTCAAGGCAGCGACTCTGCTTCTCGATAATGA
CCATAATCCGGACGTGACTTCCAAGTCGGGCTTCACCCCGCTGCACATTG
CTTCCCATTATGGTAACCAAAACATCGCCAACCTACTCATCCAGAAGGGC
GCCGATGTCAACTACTCGGCCAAGCACAACATCAGTCCGCTGCATGTGGC
TGCTAAGTGGGGTAAGACCAACATGGTTTCCCTGCTTTTGGAAAAAGGTG
GTAACATCGAGGCAAAGACCCGGGACGGACTTACTCCGCTCCATTGCGCC
GCTCGCTCGGGTCATGAGCAAGTTGTTGACATGCTACTCGAACGAGGAGC
TCCCATCTCTGCCAAGACCAAAAATGGTTTGGCACCCCTCCATATGGCCG
CCCAGGGTGAGCATGTTGATGCCGCCCGCATCCTCTTGTACCATCGTGCT
CCCGTCGACGAGGTGACAGTGGATTATCTCACTGCTCTTCATGTGGCTGC
TCACTGTGGTCATGTTAGGGTGGCTAAGCTTTTACTAGATCGGAATGCTG
ATGCCAATGCAAGGGCTTTGAATGGATTCACTCCACTGCACATTGCCTGC
AAGAAGAACCGCTTGAAGGTGGTAGAGTTGCTCTTGCGACATGGTGCCAG
CATTAGTGCCACGACAGAGAGTGGACTTACTCCGCTCCATGTGGCCGCCT
TTATGGGTTGCATGAACATTGTCATCTATCTGCTGCAGCACGATGCCAGT
CCCGATGTGCCCACTGTGCGCGGAGAAACGCCACTCCATTTGGCCGCCAG
AGCCAACCAGACCGACATCATTCGAATCCTGCTGCGCAATGGCGCCCAGG
TGGACGCTCGTGCCCGAGAGCAACAGACACCGCTGCACATCGCTTCGCGA
CTGGGTAATGTAGACATCGTGATGCTTCTGCTGCAACATGGCGCCCAAGT
GGACGCAACCACCAAGGACATGTACACGGCACTTCACATCGCTGCCAAGG
AGGGCCAGGATGAGGTAAAAGATCTGATTGCGAAAAAGATCACCGACCAC
ATCGACACCGTTTATCTGATGCAACTGTTTTGGATACGCCATCAGGAGTT
TTTCATTGCAAGCTTTCTAGACCAT

BO20925.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
Ank2-RE 2094 CG42734-PE 1..2091 17..2107 10455 100 Plus
Ank2-RK 12795 CG42734-PK 1..2000 17..2016 10000 100 Plus
Ank2-RR 13491 CG42734-PR 1..2000 17..2016 10000 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:21:38
Subject Length Description Subject Range Query Range Score Percent Strand
Ank2-RE 2780 CG42734-RE 556..2646 17..2107 10455 100 Plus
Ank2-RK 14309 CG42734-RK 556..2555 17..2016 10000 100 Plus
Ank2-RR 15005 CG42734-RR 556..2555 17..2016 10000 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7709519..7710283 1810..1046 3825 100 Minus
3L 28110227 3L 7717366..7717840 491..17 2375 100 Minus
3L 28110227 3L 7710349..7710802 1045..592 2270 100 Minus
3L 28110227 3L 7709054..7709354 2107..1807 1505 100 Minus
3L 28110227 3L 7710868..7710970 592..490 515 100 Minus
4 1348131 4 122410..122567 1605..1448 250 77.2 Minus
Blast to na_te.dros performed on 2014-11-26 15:21:35 has no hits.

BO20925.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:29 Download gff for BO20925.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 500..2590 17..2109 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:31:04 Download gff for BO20925.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 556..2646 17..2109 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:39 Download gff for BO20925.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 556..2646 17..2109 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:39 Download gff for BO20925.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7717367..7717840 17..490 100   Minus
3L 7710868..7710969 491..592 100 <- Minus
3L 7710349..7710801 593..1045 100 <- Minus
3L 7709519..7710283 1046..1810 100 <- Minus
3L 7709051..7709350 1811..2109 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:31:04 Download gff for BO20925.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7710467..7710940 17..490 100   Minus
arm_3L 7703968..7704069 491..592 100 <- Minus
arm_3L 7703449..7703901 593..1045 100 <- Minus
arm_3L 7702619..7703383 1046..1810 100 <- Minus
arm_3L 7702151..7702450 1811..2109 99 <- Minus

BO20925.pep Sequence

Translation from 16 to 2125

> BO20925.pep
MAQFVTHIQPTLMEASQGHVPHHHGHQVGVQHSSHLPHSGHNMPSPPTHN
HHHAHGHGHHTSSGGHHGGAGGHSQKQAAHHSTTSGHAAKGQHHSPPSRI
HSPPTEHHPDHVGHYEYFQHQHEQIFHHEGANGGASHKQQTHHHPNKHEH
CPTGHQSAGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHL
ASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHN
ASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVA
MQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDV
TSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGK
TNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAK
TKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHV
RVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT
ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTD
IIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK
DMYTALHIAAKEGQDEVKDLIAKKITDHIDTVYLMQLFWIRHQEFFIASF
LDH

BO20925.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Ank2-PE 697 CG34416-PE 1..697 1..697 3684 100 Plus
Ank2-PK 4264 CG34416-PK 1..667 1..667 3524 100 Plus
Ank2-PR 4496 CG34416-PR 1..667 1..667 3524 100 Plus
Ank2-PW 1309 CG42734-PW 1..667 1..667 3524 100 Plus
Ank2-PV 4373 CG42734-PV 1..667 1..667 3524 100 Plus
Ank2-PK 4264 CG34416-PK 355..902 161..671 887 36.1 Plus
Ank2-PR 4496 CG34416-PR 355..902 161..671 887 36.1 Plus
Ank2-PW 1309 CG42734-PW 355..902 161..671 887 36.1 Plus
Ank2-PK 4264 CG34416-PK 420..944 160..681 864 38.6 Plus
Ank2-PR 4496 CG34416-PR 420..944 160..681 864 38.6 Plus
Ank2-PW 1309 CG42734-PW 420..944 160..681 864 38.6 Plus
Ank2-PK 4264 CG34416-PK 329..838 168..673 838 36.3 Plus
Ank2-PR 4496 CG34416-PR 329..838 168..673 838 36.3 Plus
Ank2-PW 1309 CG42734-PW 329..838 168..673 838 36.3 Plus
Ank2-PK 4264 CG34416-PK 160..541 292..673 565 36.3 Plus
Ank2-PR 4496 CG34416-PR 160..541 292..673 565 36.3 Plus
Ank2-PW 1309 CG42734-PW 160..541 292..673 565 36.3 Plus
Ank2-PK 4264 CG34416-PK 168..512 329..677 524 34.7 Plus
Ank2-PR 4496 CG34416-PR 168..512 329..677 524 34.7 Plus
Ank2-PW 1309 CG42734-PW 168..512 329..677 524 34.7 Plus
Ank2-PK 4264 CG34416-PK 758..1003 135..369 249 27.3 Plus
Ank2-PR 4496 CG34416-PR 758..1003 135..369 249 27.3 Plus
Ank2-PK 4264 CG34416-PK 745..925 155..331 247 32 Plus
Ank2-PR 4496 CG34416-PR 745..925 155..331 247 32 Plus
Ank2-PW 1309 CG42734-PW 745..925 155..331 247 32 Plus
Ank2-PW 1309 CG42734-PW 758..932 135..309 239 32 Plus
Ank2-PK 4264 CG34416-PK 160..317 519..676 213 31 Plus
Ank2-PR 4496 CG34416-PR 160..317 519..676 213 31 Plus
Ank2-PW 1309 CG42734-PW 160..317 519..676 213 31 Plus