Clone BO21404 Report

Search the DGRC for BO21404

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:214
Well:4
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO21404.pep: Imported from assembly
Sequenced Size:1381

Clone Sequence Records

BO21404.complete Sequence

1381 bp assembled on 2010-10-13

> BO21404.complete
GAAGTTATCAGTCGACATGATGCTAATGCACGAGAAACTCATGGCCGGGC
AGTTCTTCGATCTCAAGACTGATCGCAAGCCCCTGATGCACCACCACCAG
TACCAGCACCACCAGCAGCAACCACTGCACCACTTGCCGCACAGCCAATT
GCCGGTTCAGGGATCCTTGGGCCTACCCAAAATGGATCTGTACACGGCCT
ACGCCTACCAGCAGCAGTTGCTGGGAGCTGCCCTCAGTCAGCAGCAACAA
CAGCAACAGCAGCAGCAGCAACATCAGCAGCTGCAGCAGCAGCATACCTC
CTCTGCAGAGGTCCTGGATCTTTCCCGTCGATGTGACAGCGTAGAGACAC
CCAGGAAGACTCCCTCGCCGTATCAAACAAGCTATAGCTACGGCAGTGGT
TCCCCCTCGGCTTCGCCCACCAGCAATCTTCTGTATGCCGCCCAAATGCA
ACAGCAGCAACATCAGCAGCAACAACAGCAACAGCAGCAGCAGCAACAAT
TAGCCTCCCTGTATCCCGCTTTTTACTACAGCAACATCAAGCAGGAGCAA
GCCACGCCCACTGCTGCTCCGCCCAAGGTTACACCAACCGCTAACCTTCT
GCAAACCTTTGCTGCCGCCTCTGCTGCGGCCGCCGCTGCTGCTGCCGCTT
CTTCGACCAACTCACCAAGACCCGCCAGCAACGCCAGCACCATGCAGATA
GACGTTCTGGAGAATCCCCTGTCACCGGCTGTTGAGGCCACCACGCCAAC
CACCTCCAGCAGCGGCGAGGCGGGAAAGAACACCCGTCCCTTCAAGGCCT
TTCCCCGGGATCCCTTGGTCATAGCTGCCAATTTCGCAGCCACTGATGTC
CTTTTGGACAATCCGCGAGTGGAGCGCTACACGGAATACCGGAAGCGAGT
GCTTGAGCAAATCCGCAGCTCCAACGGAGGATCGCGCACCGTAACCAACC
CAAAAATGCGAAGGACCAACTCAAGAAGTGGATCCGTCAACGAAGGCAGC
TCCTCAAACAACAACAGCGAAAGCGAGGATCGCGCTGCTGCGGAGGAGTC
AAGCGACTGTGACTCCCAGGCGGGCAACTTCGAGAGCAAGTCCGCCACCA
GCAGCTCCAGCAACTTGGCTAACGCTACTGCAGCAAACTCGGGCATCAGC
TCGGGCAGCCAGGTTAAGGATGCCGCATACTACGAGAGGCGTCGCAAGAA
CAATGCTGCCGCCAAGAAGTCCCGCGATCGCCGCCGCATCAAGGAGGATG
AGATCGCCATCAGGGCCGCCTATCTGGAACGCCAGAACATCGAGCTCTTG
TGCCAGATCGACGCCCTCAAGGTCCAGCTGGCCGCCTTCACCTCCGCCAA
AGTAACCACCGCCGCAAGCTTTCTAGACCAT

BO21404.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
gt-RB 1347 CG7952-PB 1..1344 20..1363 6720 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
gt-RB 1780 CG7952-RB 116..1459 20..1363 6720 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2427434..2428726 1363..71 6465 100 Minus
X 23542271 X 6950774..6951010 1127..1363 1095 97.5 Plus
X 23542271 X 2428801..2428852 71..20 260 100 Minus
Blast to na_te.dros performed 2014-11-26 14:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2347..2387 649..609 115 75.6 Minus

BO21404.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-13 16:24:55 Download gff for BO21404.complete
Subject Subject Range Query Range Percent Splice Strand
gt-RB 109..1455 17..1365 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:27:59 Download gff for BO21404.complete
Subject Subject Range Query Range Percent Splice Strand
gt-RB 113..1459 17..1365 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:15 Download gff for BO21404.complete
Subject Subject Range Query Range Percent Splice Strand
gt-RB 113..1459 17..1365 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:15 Download gff for BO21404.complete
Subject Subject Range Query Range Percent Splice Strand
X 2428801..2428855 17..71 96   Minus
X 2427432..2428725 72..1365 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:27:59 Download gff for BO21404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2322834..2322888 17..71 96   Minus
arm_X 2321465..2322758 72..1365 99 <- Minus

BO21404.pep Sequence

Translation from 16 to 1381

> BO21404.pep
MMLMHEKLMAGQFFDLKTDRKPLMHHHQYQHHQQQPLHHLPHSQLPVQGS
LGLPKMDLYTAYAYQQQLLGAALSQQQQQQQQQQQHQQLQQQHTSSAEVL
DLSRRCDSVETPRKTPSPYQTSYSYGSGSPSASPTSNLLYAAQMQQQQHQ
QQQQQQQQQQQLASLYPAFYYSNIKQEQATPTAAPPKVTPTANLLQTFAA
ASAAAAAAAAASSTNSPRPASNASTMQIDVLENPLSPAVEATTPTTSSSG
EAGKNTRPFKAFPRDPLVIAANFAATDVLLDNPRVERYTEYRKRVLEQIR
SSNGGSRTVTNPKMRRTNSRSGSVNEGSSSNNNSESEDRAAAEESSDCDS
QAGNFESKSATSSSSNLANATAANSGISSGSQVKDAAYYERRRKNNAAAK
KSRDRRRIKEDEIAIRAAYLERQNIELLCQIDALKVQLAAFTSAKVTTAA
SFLDH

BO21404.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
gt-PB 448 CG7952-PB 1..448 2..449 2262 100 Plus
Smr-PF 3601 CG4013-PF 59..307 28..237 202 30.7 Plus
Smr-PE 3601 CG4013-PE 59..307 28..237 202 30.7 Plus
Smr-PD 3601 CG4013-PD 59..307 28..237 202 30.7 Plus
ASPP-PA 1020 CG18375-PA 165..579 15..451 197 24.6 Plus
Smr-PF 3601 CG4013-PF 515..826 27..379 167 24.9 Plus
Smr-PE 3601 CG4013-PE 515..826 27..379 167 24.9 Plus
Smr-PD 3601 CG4013-PD 515..826 27..379 167 24.9 Plus