Clone BO21428 Report

Search the DGRC for BO21428

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:214
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptMio-RA
Protein status:BO21428.pep: Imported from assembly
Sequenced Size:3391

Clone Sequence Records

BO21428.complete Sequence

3391 bp assembled on 2010-10-20

GenBank Submission: KX794982

> BO21428.complete
GAAGTTATCAGTCGACATGATGCTGAATAAACACGAGGGATACCAACGCA
CAAGCCAAATGTTTCCCCACCAGCAGCACCAGCTGCCTCAGCTGCACCAG
CAGCCTTATCTGCAACAGTCTCTGTGCCAAAACTTCCAGCAATTGCAGTA
CGAAACGGGAGTAGGTGCTTCGGCGTCAGGGTCCGCCGAGGCTACGGCAG
ACCTGCTCAAGGCGGAGCGGGAGTCTATCCACTCCGGCCAGTTTATGGTC
TCGCACTTCGAGGCAGAGGAGGCGCAGGACGACCTAGAGGATGACGGCGA
GGTGAAGATGCTAGACCCTGAGGACCCCGGTCTGGGCAAGCCGGGCGAGC
CAACCAACACATGTCGTGACGTGCAGCTTTACGTACCCCAAACAGTGGCC
CACTTCAGCGCCATGGACCAGGAGGGCGACGAGAGCAGCATGAGCATGGT
GACCTCCCACCTGGAGATAGAGACCTCGCTCACCAAACTCTTCAAGTGCA
TGAATCTGGCCTACAGTCAAAAACTAACCTCACCCAAATGGAATCATTTC
AAAGGAGTACGACTTCGGTGGAAGGACAAAATTCGCCTGAACAATGTCAT
CTGGCGTTGCTGGCACATGCAGTTCATACAAAAGCGCAGAACCCCGGTGT
GTCAATTTGCGTCGCCGCTGGACGTTGATATACATAGTAATCCTCAAACT
GTTGTTCTTGAAGGCAAATACTGGAAACGGCACTCAGCTGTTATAAAAGC
CGAATACAGGAAATGGCGCAGGAACTATAGGTCGAAGGCTACGGGCTGCT
TAACATATGATTCGAAAAGCGAATTAGACTTTTTGGAATGGTCGCCTCTG
AACGATAGGAACTTAATGCCAGACGATTGGACCACAGACACCTTATTCTC
GGCTATAAACGTTCCATTCCCATTTCCAGATTCTAGGGAAATCGCACGCG
GCGCGGGCATCGCGGACTTTATACAGCCCAGTCTTGGTCCCTTGCAACCG
AATTTAGATGACATCGACATTAGCTTTTCAGACTTGATTCCAACCACACG
CTTGCCTCCAGTTCCAGAAGAGGGAACCGACGCTGAAATGCTCAAAAACG
ACGAATATTGCCTGTCAGCGATTGTCGGTGCTCCTCATACGCTGTATTGC
AACGATAGCATAATGGATGTGGTAAACAGCAGTAACAATGGCGCTGTAAA
TGTAGATGCTAGCATGCTTGAGCTTAACACGCCCATAAATAACGTATCGT
ACGGTGAGGTAGAGCAACGATTTTCTGTTGCACGGCAGGTGCAGCAATCC
AACAATGATTCTCAGCTTCTCGGAGACTCGGGTTCAATGTCCGGACGAAT
ACACGGAGGCAAGCATTTTGGACCTGCTAGCGCAAACGACAACAACACCA
ATAGGTGTGTTATAAACGGTCGCGTGGCCAAGAGCACTCAGCGGCCATTC
CGACGCGAGCCCCACAATTATGACAAGGCCCAGCCCACAATGCACCAGAC
GAACCTGTATCAGCAAATGTTGGCCGAACAACAGAAGAACCAGCAGCAGC
AACACGTGGTAGTGTCTTCATTTCAGGCTTCCCAACAACAGCAGCTCGCT
CAACAGCAACCCTTTTCGGCCCAGGCAACAAACGCCTTCAATAATCAGAG
TTTTATTAGCAGTTACGCAGATAACTATCAGCATCAGCAGCAACTCAACG
TCAAGGTAGAACCTCTACATGCCGATGTGCTGTCATTACTAAACGACAAT
GCATACAACTCTATTGGCTACAAGCCCTATCCGCAATTTAAGAAGTCCGC
CTCGACGGGAACTTTTCTTAATGTCCCCAGGCAGACGCAGCAGCAGCAAA
GTTATCTGCAGCAAGAGCCCCCGCAAATGCAACAGTCCCTTCCCGTAGGC
ATGGGAAATCAACAAATTTTGCAGCTTACGCGTCAGCAGCAGGTTAACAA
TACACAGCAACAGCAGCACCAATCCACAGTGGCTAGCTTGTTGCAGCAGC
AGCACCAGCAGCAAAACCATCAGCAACAGCAACTACAGACTGCTGTCAGC
TCAGCCACATGGGTTTCGCCAAACACCATTTTGCCTAAAGAAATCTACCG
CTCCAACAGCTTACCACTGAATGTTTCCCTTAATAAACTACCCGATGGTC
GCCAGCTGCATCATGAGCAGCCCTTCGCAGTGCCCAAGTATCACTCCAAA
AGCAAGTCGAGGGTGCGGAGTAATTCGATGCACCAGCAACACACTTCAGT
GGTGTCTGCTGCTGGAGCGGGAAGTTCTTCATTAGGCGCACATAGTTGCA
GCAACCTGCTGGTCACTCAGCAAATGCAGCAGGCAACCAGCGATCCCATG
CTAAACAGCACCCTGGCTCAACTGCTCACTTCGAATTCACGCCTACAAAC
AGCAGTGGCGAACAGTTCGTCATCAAATTCACCTTCCGTCAGTGCCATAG
CCACCACTAACAGCAACAGCAATGCGCCTCCGGTTCATTACGCTAACGTC
ACATCGCCGTTGTCGGTTCCGGTGCCAACACATCAACACTCACCAAAAAA
GTCCGCCTCCTTGCCTATGGCTGTCAACTCTGCATTGCACAGTCCCCCTC
TAGGAAGTAAAATACACGGTATTGGGCTGGCCACAGCTAACGTGGGCAGT
AATAGCTTGAGTTTGTCACCGGAATCGACGTTCCACGAGTCACAGGATTC
CCCACTGTCTCCTACAACCAGCCTAAAATTCCAGCCGCGAGACACGCAGC
GTCGTGCTGGCCATATCCACGCCGAGCAGAAGCGGCGTTACAACATAAAG
AACGGATTTGACACTCTGCACGCGCTCATACCACAGCTTCAGCTAAATCC
CAACGCCAAGTTAAGTAAGGCAGCCATGCTACAAAAGGGAGCGGACCACA
TAAAGCAACTGCGACAGGAGCGCAATGTTTTAAAGGATAAAATTGAAGCT
TTGCGCATGGAGCGAGACGAGCTAAACAATTCGCTGACGCACCTTCACTC
AATTTTGCCAGCTAATGGAGCGCCTGTAACGAGGCAGGGTACAGAACATG
TTCGGCAGCTTTACGACATTTATGTACGATACAATACAATGAACGACTGG
AAATTTTGGATTTTGGGTCTCATTCTGGAACCTTTGCTTGCCTCTTACAC
GTCAACAGTCTCGAGTGCTAGTCTTGATGAGCTACGTCGGACCGCTTTTC
TTTGGGTTGATCAGCACTGTTCCCTTATTGATCTTCGTCCAGCTGTTACA
AATAAATTAAAGTATCTATCTATGCATACGGATATTGTTTCGGAGCCACC
AAGTACATTGCAAGAGGAGGTGGCCAAAGCCCTCCAGAATTCAAGTGGCC
AGCATCCAAATCTGCATGGACCCGCAAGCTTTCTAGACCAT

BO21428.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
Mio-RM 3360 CG18362-PM 1..3357 17..3373 16785 100 Plus
Mio-RL 3360 CG18362-PL 1..3357 17..3373 16785 100 Plus
Mio-RK 3360 CG18362-PK 1..3357 17..3373 16785 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
Mio-RM 4068 CG18362-RM 495..3851 17..3373 16785 100 Plus
Mio-RL 3832 CG18362-RL 259..3615 17..3373 16785 100 Plus
Mio-RK 3830 CG18362-RK 257..3613 17..3373 16785 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 21288052..21289411 2384..1025 6785 99.9 Minus
2L 23513712 2L 21287390..21287994 2989..2385 3025 100 Minus
2L 23513712 2L 21308288..21308787 516..17 2500 100 Minus
2L 23513712 2L 21286295..21286427 3373..3241 665 100 Minus
2L 23513712 2L 21289615..21289745 944..814 655 100 Minus
2L 23513712 2L 21286489..21286618 3242..3113 650 100 Minus
2L 23513712 2L 21287204..21287327 3112..2989 620 100 Minus
2L 23513712 2L 21297695..21297811 814..698 585 100 Minus
2L 23513712 2L 21304825..21304936 623..512 560 100 Minus
2L 23513712 2L 21289462..21289549 1031..944 440 100 Minus
2L 23513712 2L 21301454..21301527 697..624 370 100 Minus
Blast to na_te.dros performed 2014-11-26 15:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2348..2546 1831..2035 245 61.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2304..2824 1490..2059 223 56.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6961 1838..2047 203 59.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2578..2647 1482..1554 150 71.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6864 1481..1608 135 58.1 Plus
roo 9092 roo DM_ROO 9092bp 1063..1186 1492..1619 134 59.4 Plus
roo 9092 roo DM_ROO 9092bp 1076..1149 1485..1554 125 68.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6920 1492..1694 119 54.7 Plus

BO21428.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:32 Download gff for BO21428.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RA 202..3558 17..3375 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:31:05 Download gff for BO21428.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RK 257..3613 17..3375 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:11:45 Download gff for BO21428.complete
Subject Subject Range Query Range Percent Splice Strand
Mio-RK 257..3613 17..3375 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:11:45 Download gff for BO21428.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21308288..21308787 17..516 100   Minus
2L 21304825..21304931 517..623 100 <- Minus
2L 21301454..21301527 624..697 100 <- Minus
2L 21297695..21297811 698..814 100 <- Minus
2L 21289615..21289744 815..944 100 <- Minus
2L 21289462..21289548 945..1031 100 <- Minus
2L 21288052..21289404 1032..2384 100 <- Minus
2L 21287391..21287994 2385..2988 100 <- Minus
2L 21287204..21287327 2989..3112 100 <- Minus
2L 21286489..21286618 3113..3242 100 <- Minus
2L 21286293..21286425 3243..3375 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:31:05 Download gff for BO21428.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21308288..21308787 17..516 100   Minus
arm_2L 21304825..21304931 517..623 100 <- Minus
arm_2L 21301454..21301527 624..697 100 <- Minus
arm_2L 21297695..21297811 698..814 100 <- Minus
arm_2L 21289615..21289744 815..944 100 <- Minus
arm_2L 21289462..21289548 945..1031 100 <- Minus
arm_2L 21288052..21289404 1032..2384 100 <- Minus
arm_2L 21287391..21287994 2385..2988 100 <- Minus
arm_2L 21287204..21287327 2989..3112 100 <- Minus
arm_2L 21286489..21286618 3113..3242 100 <- Minus
arm_2L 21286293..21286425 3243..3375 98 <- Minus

BO21428.pep Sequence

Translation from 16 to 3391

> BO21428.pep
MMLNKHEGYQRTSQMFPHQQHQLPQLHQQPYLQQSLCQNFQQLQYETGVG
ASASGSAEATADLLKAERESIHSGQFMVSHFEAEEAQDDLEDDGEVKMLD
PEDPGLGKPGEPTNTCRDVQLYVPQTVAHFSAMDQEGDESSMSMVTSHLE
IETSLTKLFKCMNLAYSQKLTSPKWNHFKGVRLRWKDKIRLNNVIWRCWH
MQFIQKRRTPVCQFASPLDVDIHSNPQTVVLEGKYWKRHSAVIKAEYRKW
RRNYRSKATGCLTYDSKSELDFLEWSPLNDRNLMPDDWTTDTLFSAINVP
FPFPDSREIARGAGIADFIQPSLGPLQPNLDDIDISFSDLIPTTRLPPVP
EEGTDAEMLKNDEYCLSAIVGAPHTLYCNDSIMDVVNSSNNGAVNVDASM
LELNTPINNVSYGEVEQRFSVARQVQQSNNDSQLLGDSGSMSGRIHGGKH
FGPASANDNNTNRCVINGRVAKSTQRPFRREPHNYDKAQPTMHQTNLYQQ
MLAEQQKNQQQQHVVVSSFQASQQQQLAQQQPFSAQATNAFNNQSFISSY
ADNYQHQQQLNVKVEPLHADVLSLLNDNAYNSIGYKPYPQFKKSASTGTF
LNVPRQTQQQQSYLQQEPPQMQQSLPVGMGNQQILQLTRQQQVNNTQQQQ
HQSTVASLLQQQHQQQNHQQQQLQTAVSSATWVSPNTILPKEIYRSNSLP
LNVSLNKLPDGRQLHHEQPFAVPKYHSKSKSRVRSNSMHQQHTSVVSAAG
AGSSSLGAHSCSNLLVTQQMQQATSDPMLNSTLAQLLTSNSRLQTAVANS
SSSNSPSVSAIATTNSNSNAPPVHYANVTSPLSVPVPTHQHSPKKSASLP
MAVNSALHSPPLGSKIHGIGLATANVGSNSLSLSPESTFHESQDSPLSPT
TSLKFQPRDTQRRAGHIHAEQKRRYNIKNGFDTLHALIPQLQLNPNAKLS
KAAMLQKGADHIKQLRQERNVLKDKIEALRMERDELNNSLTHLHSILPAN
GAPVTRQGTEHVRQLYDIYVRYNTMNDWKFWILGLILEPLLASYTSTVSS
ASLDELRRTAFLWVDQHCSLIDLRPAVTNKLKYLSMHTDIVSEPPSTLQE
EVAKALQNSSGQHPNLHGPASFLDH

BO21428.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
Mio-PM 1119 CG18362-PM 1..1119 1..1119 5846 100 Plus
Mio-PL 1119 CG18362-PL 1..1119 1..1119 5846 100 Plus
Mio-PK 1119 CG18362-PK 1..1119 1..1119 5846 100 Plus
Mio-PJ 1119 CG18362-PJ 1..1119 1..1119 5846 100 Plus
Mio-PI 1119 CG18362-PI 1..1119 1..1119 5846 100 Plus