Clone BO23111 Report

Search the DGRC for BO23111

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:231
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptLin29-RA
Protein status:BO23111.pep: Imported from assembly
Sequenced Size:3484

Clone Sequence Records

BO23111.complete Sequence

3484 bp assembled on 2010-10-20

GenBank Submission: KX799681

> BO23111.complete
GAAGTTATCAGTCGACATGAAATTACGATGCTTTAACCAGGCCCAAACTT
CGCACAGTTGGCACCCCAGATCCGTGTTCAGGGTCGTAAGCAGTTGTCCT
CCCGATCGAAAAAAACGGCCAAGCCCAGCGAGCTGGCAAATCTGTATTGG
CCATCTCCTAACAAATTATCTTGGAATGTTTAAAATGGACTCCGCAGACT
TCTGGCAGCAAGCGCGTGCTCCGTTTGGTCTGCAAACTGCGCTTCACCAA
TACTCTTCCCCCCCGAATCAACAGCCAATATCCCACCACGCCCTGCACCA
CTCCGTTCCGCAGGAGAACGAGCAGTTGGCCGGAGTTCAACCAGAAGGTC
CAGCAGCAGGATCAGGCGTAGTGGGCAACAACAGTTCCATGGCAATTTCC
GGCACCAATTCAACTGTGGGCAGCAAGGCGGAGTCCAGTCACATTCCGCA
GCAGCACTCAGAGCAGCAGTCATATGGAAGCGACTCCTTCCGAGGAACGC
AGTCGCCCCAGCTGAGTAGCCACCACCTGTTGTTTAACGCCGCTGCAGCC
GCTGCTGCGGCGGTCCACCTCAAGTCCACGGCGATGCAGAATAACCTCTC
GCCAATAGGCGATCAGGTGCAAAATAACCTTCGCAACTACGGACAAGGAT
CCTTAAACGCCTTATGTGGGATCAAGCCCAAGCAGGAGATGGATGCGAAG
ACGCCCCTACAGCCGTTGGACGAGTGTCCCCACCCTCTAGTTCAGGCGCA
GGCCCAGTCCCAGTACGGCGGAGACTACTACGACGTGGCCGACCCACAGG
CTAGAGAAATCTCGGAAGGTCGAGCACTGATAATCGGACTCGGAGCACCC
AGTACGGTGTCCACCGACGATGCACAGTCCAGTGCGCCGTCTCATCAGCT
GGCAGGGACTGGCCGAGCATTGCAGACTCATCAGTGCAAGCCAATGTCCC
CTGGAACAGTTGGTAGCTCGAATTTGGGCGCAGGACGAAGATCCGCACCC
ACAACAATAAGCAAGACCTTTTCGCAGGGTCAGCAGTCCCCTCAGCACTC
TACAACGCCATCCGGAGGCAGCACGACGCCCGACATCAAATACAATAACG
ACAAAATGGCCAATGAAATTCAGCTTCAGCTATCCCGTTCGAGCAGCGCA
GCGGCGATCAGTGAACGCACCCTCGAAGAATGTTGGTCAACCCTACAACG
ACTATTTATGCACAAAAGCGCGATGCAGCAAATACAGCAGCAGATTCCTC
GCGTTGGCCTGGGCACCCACGGCGTGACCGGCTCGGCCAACTTAGGTGGC
AGTATTACGCCTAGCTCGGATACCAAGCCGCACCAGTGCCAGCAATGTAT
GAAGAGCTTTTCCAGTAACCACCAGCTCGTGCAACACATCAGGGTACACA
CTGGAGAGAAGCCATACAAGTGTTCCTACTGTGATCGTAGATTTAAGCAG
TTGTCGCACGTCCAGCAGCACACGCGCCTGCACACAGGAGAACGACCCTA
TAAATGCCATCTGCCAGACTGCGGTCGAGCCTTTATACAGCTTTCAAATC
TACAACAGCATCTACGAAACCATGACGCTCAGGTGGAGCGTGCCAAAAAT
CGTCCTTTTCACTGCAACATATGTGGAAAGGGTTTCGCCACTGAATCTAG
CCTGCGTACACATACATCGAAGGAGCTACAGCTGCATCTTGGTGTCTTGC
AGCAGCATGCCGCACTAATAGGTGGTCCAAACGCTACGTCCTGTCCGGTG
TGCCATAAACTTTTCCTTGGCACTGAAGCCCTTGTGGACCACATGAAACA
TGTTCATAAGGAAAAGAGCCCCCCACCTGGTGGCTCAGCCTCATCCCAGT
TTAGCGAGCTCAATCAGATAGTTACGGGCAATGGAAACGGAACTGGATCT
AGCAATGAACAAATTGCTACCCAATGCACAACTGAATCGAACTCGCATCA
GGCCACTGTTGGCTCTAGCTTAATCGACAGCTTTTTGGGCAAGCGAAGAA
CTGCCAACCATCCTTGCCCAGTTTGCGGTAAACATTATGTCAACGAGGGT
TCCCTAAGGAAACATCTGGCTTGCCACGCTGAGAACTCCCAACTTACAAA
CAGCCTGCGAATGTGGCCATGTAGCGTTTGCCAGGCCGTCTTCACTCATG
AAAACGGCCTTCTTACCCATATGGAGTCAATGCGCATGGATCCGAAACAT
CAGTTCGCGGCTCAATACGTACTATCCCGGGCAGCTGCAGAGCAGCGAGA
ACGAGAATCTCTTCTAGCGGTTACCTTAGCCGCCAGCAGTGGCGCTAGTA
CAAGAATCGGAATTGCGGATGCCGGAAACGTTTTGCCTACGGGAGCTCAC
AACTCGGACGGATCCAACTCGAAATGCCCTTCCCCTTCGGCTAACTCGGA
ATGCTCTTCAAACGGACGCCTCTCGTCATCGACAACATCAGATCAAGACC
AAGACATCGACCATGGTTTAAGTGAAAATGAGAACAGCAACCAGAACAAC
ATAGGCAGTTCCACGAATAACAACAATAATTGCACGAGTAACAACAACGC
TAGCTCTCATAAAATGGCTGAGCTTCGACTTCCGGGAACCGGCCAATATA
CCATGGACGCGGAACTGCATGTCGCCAACCGGATGTCACTAATGGCCGCT
GCTGCTGCAGCAGTTGCTGCGTCACGACCACAAGACGGAGTGGACACTTC
AGCAGTCCCGAGCGCGGCGGTTCAGGCCGCTGTGGTTAATCTGGCAGCTG
CAATGCGAATGAACAATTCCAGCAACGGTGCTACCCCCTACCAACAACAT
CACGCCGATCACACACAGGCACACCAGACACATATCCTTCAACATGCACA
CCCACATCACCACCAACAGCAGCAGGCTCCGCAGCACCAACAGCAACAGT
TGTCCCATTTGCTAGTCCATACTCACCCCAGCAACAGCAACTCCCGTTCT
CAAAGTTCACCAAACATAAATGTGCCAAGTTTACAGAACGAATCTACTGC
CGCCTCGATCGCTATGAACATGAACGTACATATGATGCGCGGTTCCCTCG
ACCCGGACCCGAGTTTAGGAGGAATGCATGGAATAGAAGTTCTCCACCAA
CACCAGCAGCAGCACCACCACCATCATCACCACCACACGTCAAACTATCC
GCAGCACGCCGTAACTCCTACCAACCAACATACTCACCCACACCCCCAGA
CACACCAAACCGCCCATCACCATACGAGTCCTGAAACGGCGCTCCGAATG
CACCAGGCTGAAGCGATCTTACGCTCGCATACCGAAGCAGCATTCCGACT
GGCAACTGGATCTGGTCCTGACACCGGAGTAAAATGCGAGGCTGATCAAA
ACCAGCTGAATAGTAACAATGCTGGCAATGCTGGTGGCAATAGTGGAGGC
AATAGCCAACAACATCGATTCCATGCGAGTTCGAATCACCAAGAGAATCA
ACGACCATCGGACTCAGCAAGCTTTCTAGACCAT

BO23111.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Lin29-RA 3453 CG2052-PA 1..3450 17..3466 17250 100 Plus
Lin29-RC 3453 CG2052-PC 1..3450 17..3466 17250 100 Plus
Lin29-RD 2376 CG2052-PD 31..2373 1124..3466 11715 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
Lin29-RA 3937 CG2052-RA 162..3611 17..3466 17250 100 Plus
Lin29-RC 5533 CG2052-RC 1758..5207 17..3466 17250 100 Plus
Lin29-RD 3163 CG2052-RD 495..2837 1124..3466 11715 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 390425..391531 1123..17 5535 100 Minus
4 1348131 4 375966..376631 3466..2801 3330 100 Minus
4 1348131 4 377094..377669 2800..2225 2880 100 Minus
4 1348131 4 377884..378208 2157..1833 1625 100 Minus
4 1348131 4 382122..382408 1488..1202 1435 100 Minus
4 1348131 4 378715..378902 1673..1486 940 100 Minus
4 1348131 4 378396..378563 1838..1671 840 100 Minus
4 1348131 4 386907..386989 1201..1119 415 100 Minus
4 1348131 4 377758..377826 2224..2156 345 100 Minus
4 1348131 4 376811..376864 2788..2735 240 96.3 Minus
Blast to na_te.dros performed 2014-11-26 15:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6719..6828 2789..2898 199 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2603..3016 3080..3474 178 55.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..6901 2744..2896 161 59.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2309..2390 2815..2899 157 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1503..1580 2822..2899 147 65.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6718..6795 2821..2898 147 65.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6809 2855..2941 131 62.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6794 2865..2941 119 65.4 Plus

BO23111.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:48:19 Download gff for BO23111.complete
Subject Subject Range Query Range Percent Splice Strand
CG2052-RA 142..3591 17..3468 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:30:35 Download gff for BO23111.complete
Subject Subject Range Query Range Percent Splice Strand
Lin29-RC 1475..4924 17..3468 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:10:35 Download gff for BO23111.complete
Subject Subject Range Query Range Percent Splice Strand
Lin29-RC 1758..5207 17..3468 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:10:35 Download gff for BO23111.complete
Subject Subject Range Query Range Percent Splice Strand
4 390425..391531 17..1123 100   Minus
4 386907..386984 1124..1201 100 <- Minus
4 382123..382408 1202..1487 100 <- Minus
4 378716..378900 1488..1672 100 <- Minus
4 378396..378561 1673..1838 100 <- Minus
4 377885..378202 1839..2156 100 <- Minus
4 377758..377825 2157..2224 100 <- Minus
4 377094..377669 2225..2800 100 <- Minus
4 375963..376631 2801..3468 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:30:35 Download gff for BO23111.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 411051..412157 17..1123 100   Minus
arm_4 407533..407610 1124..1201 100 <- Minus
arm_4 402749..403034 1202..1487 100 <- Minus
arm_4 399342..399526 1488..1672 100 <- Minus
arm_4 399022..399187 1673..1838 100 <- Minus
arm_4 398511..398828 1839..2156 100 <- Minus
arm_4 398384..398451 2157..2224 100 <- Minus
arm_4 397720..398295 2225..2800 100 <- Minus
arm_4 396589..397257 2801..3468 99 <- Minus

BO23111.pep Sequence

Translation from 16 to 3484

> BO23111.pep
MKLRCFNQAQTSHSWHPRSVFRVVSSCPPDRKKRPSPASWQICIGHLLTN
YLGMFKMDSADFWQQARAPFGLQTALHQYSSPPNQQPISHHALHHSVPQE
NEQLAGVQPEGPAAGSGVVGNNSSMAISGTNSTVGSKAESSHIPQQHSEQ
QSYGSDSFRGTQSPQLSSHHLLFNAAAAAAAAVHLKSTAMQNNLSPIGDQ
VQNNLRNYGQGSLNALCGIKPKQEMDAKTPLQPLDECPHPLVQAQAQSQY
GGDYYDVADPQAREISEGRALIIGLGAPSTVSTDDAQSSAPSHQLAGTGR
ALQTHQCKPMSPGTVGSSNLGAGRRSAPTTISKTFSQGQQSPQHSTTPSG
GSTTPDIKYNNDKMANEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHK
SAMQQIQQQIPRVGLGTHGVTGSANLGGSITPSSDTKPHQCQQCMKSFSS
NHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHTRLHTGERPYKCHLP
DCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSLRTHT
SKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEK
SPPPGGSASSQFSELNQIVTGNGNGTGSSNEQIATQCTTESNSHQATVGS
SLIDSFLGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMW
PCSVCQAVFTHENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLL
AVTLAASSGASTRIGIADAGNVLPTGAHNSDGSNSKCPSPSANSECSSNG
RLSSSTTSDQDQDIDHGLSENENSNQNNIGSSTNNNNNCTSNNNASSHKM
AELRLPGTGQYTMDAELHVANRMSLMAAAAAAVAASRPQDGVDTSAVPSA
AVQAAVVNLAAAMRMNNSSNGATPYQQHHADHTQAHQTHILQHAHPHHHQ
QQQAPQHQQQQLSHLLVHTHPSNSNSRSQSSPNINVPSLQNESTAASIAM
NMNVHMMRGSLDPDPSLGGMHGIEVLHQHQQQHHHHHHHHTSNYPQHAVT
PTNQHTHPHPQTHQTAHHHTSPETALRMHQAEAILRSHTEAAFRLATGSG
PDTGVKCEADQNQLNSNNAGNAGGNSGGNSQQHRFHASSNHQENQRPSDS
ASFLDH

BO23111.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
Lin29-PA 1150 CG2052-PA 1..1150 1..1150 6123 100 Plus
Lin29-PC 1150 CG2052-PC 1..1150 1..1150 6123 100 Plus
Lin29-PB 1140 CG2052-PB 1..1140 1..1150 6053 99.1 Plus
Lin29-PD 791 CG2052-PD 8..791 367..1150 4177 99.7 Plus
rn-PC 692 CG42277-PC 43..419 203..609 358 28.8 Plus