Clone BO24918 Report

Search the DGRC for BO24918

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:249
Well:18
Vector:pDNR-Dual
Associated Gene/TranscriptSpt20-RA
Protein status:BO24918.pep: Imported from assembly
Sequenced Size:5653

Clone Sequence Records

BO24918.complete Sequence

5653 bp assembled on 2010-10-15

GenBank Submission: KX793865

> BO24918.complete
GAAGTTATCAGTCGACATGCAAAGCCTGGACTCCTCATGCCAAGAAGCCG
ACTTTATTATAAATGACACGCTCAAAAAGTTAAAGGGTTCCAGCAACGCG
GACCATGTCCAGGGCCTAGCGGTCCACGCCCACGGTTCGGGTGTCCACCA
GACGCAGTTCGTCCAGTACGGCACGTCTGGATCCTCGCCGCAGCTGCAGC
CGCAGCAGTCCTACCATCAGCTGCATCCCACGCTCCAGCAGCAGCAGTTC
GCCTCCTCGAGCAGCAAATCGTACCTGGAGACCAGCCTATTGCAGGCTAT
ACCACAGATTCCTGCCCAGCCGCCCATTTGTATCTTCGATGACGACGAGT
CCCCCACCGAGGGCACTGGCGGCTCACTGGGCAGCCTGCTCACGGAGCCG
ACCTCGGCCACGCCCAGCGGCCTGCCCACTGCAATTGCTCCGTCGCCCTC
CTCGTGCTCATCCTCCACCACAACGATGTCGAACTTCAACTCAATCACGT
CGCCGTCGCCGGTGGTGCCCGATCTTCTGCTGTCGACACCGCCGGGCGTT
AACTCCAGTCTAAGCAATAGCTCAACGGGAGCGGCCAGTGTGTCCAGCAA
GAAGTCCGAGAAGCGGCCACCCTCCGCCAACTCAACAGCCAGTGGAGGCG
GCCACCACCTGCACCATCATCACCTCCACCAGACGCACAATCACCATGTC
CTGGCATCGCCCACGTCGTCGCCCAGCAAGCGCCAGAAGTCCAATAGCAG
TAGCAAGGAGAGCAGCTCCTCTAGTCGCAGCTCAGCTATACCCGCCGCAT
CAGTCTCCACAGCCACCTCGTCGTCGCAATCAGCGCGCGCTGGCGCCGGC
GCTGCCTCCTCCAATAGCAACAGCAAGCCACCTTCATCCGTCTGCCAGTC
GGGCAACAGCAAGTTCTTTAATCTGCACGAGAAAATAAGGGACCTGTACC
TGCAACTGCTGAGCAACGACCTAAACTACTTTGCCGAGACAGGGCTAAAG
CAGCGCACTCGATCCTTTACACTGGAGCGGTTGGTGGATCGGGAGAAGCT
CAACACGATTGTGGTCAACTTGTATCCCGGCAATAAGGGATACTCGCTGG
CCCTGCATTATGACGAGCACATGGTGCTAAATCCGCAAACAAACGAATGG
TCCCCCACGGACAAGGACGAGACCTCGAGCGATGCTGCGGGATTGGGTAC
GGGAACGGGCAGTCATCGGAGTCGTCCCAAGCCGCTAGCCCAGGACGAAA
GTCAATCCAAGACGGAGGCGGGTCACGCCAAACACGATTTTGGACTCGTG
GAGGTGCTTCGGTGGCCCTACGAGAACGATTTGCTGCTGCAATGCATCGA
TCGTGAAATGCTGCCGGAGTTTTTAATGGATCTACTCGTAGCGGAGACCG
TCAGTTTGTCGGATGGCGAGGGAACACGGGTGTACGCCAAGCCTAGCGTC
TTCTATGCCGGCTGCGTTATCGCCCAGATCCGCGACTTCCGCCAGACATT
TGCCACCTCAACGAATATCTGTGATATGAAGCACATCCTGCTCAGGCCCA
CGAACGCCACCCTATTCGCGGAAGTGCAGCAAATGGGCAGCCAGTTGCCG
GCGGAGGACAAGCTCGCCCTGGAGAGCCAGCTGGTGTTGGCCACGGCGGA
GCCGCTGTGTCTGGAGCCGGATCCCAGCATAGGGCGGCAGGCCATCAACT
CCCAGCATCAGCGTCAGCTGTACAACTCCCACGAGCTGCGGCGCCAGATG
AAGAAGTTCACCCAAACGGCTATCAATCGGAAGCGCAAGTTGGACCAATT
CACTCACCATCACGGACTGGAATTGTGCGATTACCTGGCTCGCCTGCGCC
AGCGACCGCGGACGGGAAGTAGCAGTGGTGGCGCCAATGCCACACCGGCC
ACGGCGCCCACCAACAATCCGCTGGTGGGGGCCATGCTCTCTTCGTTCAC
ATCGAAGGTGCCCCGGCGACCACACGAGGTCATACGGCCCATTCGTCCGC
CCACACTGGAGTATCCCGCCAATCTGAAGGTGCCCGAGCACGTGATCAGC
GTGGAAAAGTATGCCAAGGCCTACGAGCCCCTTAACGAATTCAGTGAGGC
CTGCAAGGACGGTTGCCAGCCAAACTGTCGTCATAACTTCCAACCGCAGC
TGGTCGAGGAATACATTCTTGAGACGGAGCGGGAGGCGAGTGAAGGCCGG
CGGGCTCTATACCACATAAAGCTGTCCATTTTCCAGCGCCCCTCCGATGC
AGAGTATCTCGGCGAGCTCTATGTGGACCGAGATTACCGGGAGGGTGAGC
GAAACGGCGAGTCGTGCCGCTTTGCGCTGGGCACTCGGGTGCATGCCAAT
CGATACATTCAACAGTTCCGCGAGATCTTCACCGAGGAGGGACGTAAGGC
GGTCAAAATCACGCATTTGATACCCGGGCATATGCCAATTGTGACTCACA
CGGGATTGACGAATGAGCAGCGGATCCTCTTGCAGCAGCAACAACAGCAG
CAGCAGCGTCAAGCTCAAATGCAGCAGCAACAACAACAGCAGCAGCAGCA
AGTCGTTGTTGTTGCCAATCAGCAGCAACAATCGCAACAACAACAGCAGA
CACAACAAGCGGGACAGCAGTTATCCGCCACAGTGCATCATGTTGCACTG
CCGCGACAACAAATAACTCAAAAGACTCTCAATTTGGCTGGAAGTAATGT
AATCAATGTACAACAAAACTTTCGGCAACAATCAGCGCAGCAGCAGCAGC
CGCAAACATACACAATTGAGGCACCGCAGCAGCAAGCTGCAGCACAGATT
GTCCCGCAACAACAGCAGCAGCAGCAGCAGCAACAACAACAACACATACA
TCTTCAGCAGTTGGCCACCGGCAGCAGCAATACCTCCACAACAACGCACC
AAGTTAGCCTCAGCAATGGTTCCCTGGTCCTTGTGCAACAGCAGCAGCCA
CAGCAGCAATCGCAACAGCTGGCACAGGCGCTGCAACATTCGGGCATAAC
CATCCAGCCCGCCACCATTCAACAGCAGCAACAGCAGGTGAAGGGCACTT
CCGTGGTGGGGGCCAATTCAGCGCTGCGTGCCCAGCTCAACTCAAATGTG
CCAATACTGCAAACGCAGCTGAAAGTGCAGCAGCAACAGATTATGCAGAA
GCAACAGCAACAACAGACAACTGCCACTAGTAACAACAACAACAACAATA
ATAACAATAACAATATGAACAACAATACGGCCATACATCCGAATCCTGCA
ATAAACGCCATAGTCAACAGCATTATGAACTCTGCCAACCAGTACCAGCA
ACAACAGCAGCAGCAACACCAGCAGCAGCATCAGCAGCAAACGGGGAACA
CGTCGAGCAACAATAATGCTGCAGGGTCAGGCGGCAGCACCAACAACAAC
GGAAGTAGCACCAGTGCCACAACCCTCAAGAACTCCAGCAATGCGTCAAT
TTTAAACCTGCTCAACAGTGCTCCAGCTGCGATGACCAGCACACCCGTGG
CCAGTGGAACGTTCACCACCTCCACCGGCCAGCAGCAACCGCAGACGCTG
ACGCTTGTGCAGCACCAGCAACAGTCGACGCCAAACACTGCCGATGCGGC
CACCGCTACGTATGTGCAGACCACCCGTGGCACACCCACGCTGGTGAGTA
CGCAGCGGAAGCAGCAGTCCAGCGAAGTGTTGCAAAATCTGTTGAACGCC
AATCGAAAGATTGGTGGCGGAGGCACCACAACGACAACTTTTCGAACAAA
CTCCGCGGGCAATTTGATAGCGGTCAACCTCAACCAAGCCGGCCAGTCGC
ATCACCAACAGACAGGCGACGGCAGCCAGACGGTTAGAGTGTCCATGTCG
GCGCTTGCCTCGCAGTTGGCCTCGCCGCCCGCAGTGATGACAAACCCCAC
CACCAGCTACACAGTGATCTCGTCGGGCAACAGTGCCGCGGCGGCGGCAG
CATGGATTCAGAGCCCAACGGGCCCAGTTCAGCAGCGCATTCTGAGCTCC
CTGAGAAGAGATAGCACCACAGCGCCGCCCAACGCAATTGTGGTGGGCAT
GGCCGCTCCTTCTCCAGGTAGCGATTCGAACGCCTCGAATGCCAGTGGCT
TTGCTGTGCCAAACAATCTAGCGTCCACTTCAAGTGGTGGTGGCGGCGGT
GGTGGAGCCCTGTCCGCCTTGCTGACCAACGCAGCAACTCCCTCGCCATC
GGGCTCGGATCACTCGCAGTCGTCGCAGACGCACCAAAACCAAGCCCTGC
TGGAGCGCCTAAGCAATGTCACATCAAACGTATCCGCCGTTTCCATGCCG
CACATGTCACCGCAACAGCCGCAGCCAACGCAGCAGTTCATCACGAAAAC
CATCGTTCACTCTCCCGCCACATCTTCGATACACTCGCCCATGTCTAGTC
CGCATCCGCAGCCCTCTGCCTCGCCGCAGCAGCAACAACAGCAGCAGCAG
CAACAGACCACCGCCACTTTGAATCTGCAGGGCATCAATCTGTCTCAACT
GCAGGGCGCTATGGCTAACTTTGCCGGCCTGCAGAATGTCCAGGTGCAGA
TCCCCGGCTTCACACAGCCCATTTCGCTGCAGTTCTCCGGTAACAGTTTG
CAGCAACAACAGTCGGGTAATACGGCTACTGGTGCGGGCACAGCGCAGGG
CCAACAGAGAAGTGTCCTGGTCTCGGTTCCAGTCTCCAGCCAACAACAGC
AACTGCCACACACCATAACGCTGCAGACTCAGTCGGCGCCGCACCACCAG
CAGCAGCATCAGCAGACTCAGCAGCAACATGCCCCACCAACGGGCACCAT
TGTGAGCCTGCCATCGTCGGGACCTGGCACACAGACGGTCGTCATTACGA
ATAACTCCGGCGGAGGAGTGACGGCGGGAAGCAGCACCAGTGGCAGTGCG
GGCGGCGGTGGAGGATCAGGGGCCACAACGGCCATGCTCACCCTTCCCAT
TGCTCAAATAGTCGGTGCCGGTGTACAGAAACTAAATCCTCAAACAATAC
GTACCTCAAATGTTGGTGGTGGTATAGGTATCGCCCAGCAAACGGTCCAG
CAGCAGACGATTCAGTCGCAGTCGGGCGGCAACAGCACCGCGGCCATCCA
GCTGCTGGGCACCATACAGCCGCGTGCCCGCAACGTCCAGGTGGTGGGCA
CCAAGCAATTGGCCAACAGGCAGCTCATCACCACCCAGCGGCAGATAGGT
GGCTCCACGCTTAAGATCGCCACCACACCCGTGAACGCTGCCAATGTGGT
GACCAGCAGCGCCAACCTAACCACCACTCCGATTGTGATGTCCGCACAGA
AGCTGCAATTGAAAACGGTGAAGGCGCCCGTGCAACAGCAGCAACAGCCT
CAGCAACAGCAACAGCAGCTGCAGCAACAGCACCGAATACTCAACCAGCA
GAGCACGGCCACGGTGTCGTCGCAAACACTGCCCAGTCCCAACCAAGTGC
AGGTGGCCCAGCAGCAGCAGCAGCAGCAACAGCAGCTGCAGCACATTCAG
ATCGCCGGTAGGGCCACCACCGCTTCGGGAGCCATCAGTCAAAGGACTCT
AACAGCTCTGGCGGCTGCGAAGCAGCAGCAGCAGCAACAACAGGCTGCGG
TCAATCGACGGCGCTCCACCACCGATGCGACCAAGGCAAGCTTTCTAGAC
CAT

BO24918.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
Spt20-RD 5622 CG17689-PD 1..5619 17..5635 28095 100 Plus
Spt20-RA 5622 CG17689-PA 1..5619 17..5635 28095 100 Plus
Spt20-RC 4941 CG17689-PC 1..4936 17..4952 24680 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
Spt20-RD 7161 CG17689-RD 642..6261 16..5635 28100 100 Plus
Spt20-RA 8007 CG17689-RA 642..6261 16..5635 28100 100 Plus
Spt20-RC 7335 CG17689-RC 642..5578 16..4952 24685 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13504455..13506570 994..3109 10580 100 Plus
3L 28110227 3L 13506935..13508545 3342..4952 8055 100 Plus
3L 28110227 3L 13503456..13504401 53..998 4715 99.9 Plus
3L 28110227 3L 13509397..13509795 5237..5635 1995 100 Plus
3L 28110227 3L 13509049..13509334 4952..5237 1430 100 Plus
3L 28110227 3L 13506639..13506871 3109..3341 1165 100 Plus
Blast to na_te.dros performed 2014-11-26 15:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2334..2989 2483..3194 386 57.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2356..2936 2466..3037 386 57.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2478..2982 2483..2969 369 58.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6531..7036 2934..3432 362 59.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2305..2892 2870..3436 341 57.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6725..7079 2804..3161 300 58.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2459..2912 3115..3593 299 58 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..7062 2823..3184 244 59.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6718..7118 2938..3335 239 57.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..7189 2935..3342 206 55.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6711..6827 4677..4791 182 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6770..6880 4691..4800 182 68.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2282..2406 4666..4791 176 63 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6740..6842 4691..4791 167 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6791..6893 4691..4791 167 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6749..6840 4691..4779 163 69.9 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3192..3322 2838..2967 155 63.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2340..2428 4691..4779 147 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2336..2396 4738..4799 145 72.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2337..2433 4691..4790 141 64.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2394..2493 4691..4791 140 66 Plus
roo 9092 roo DM_ROO 9092bp 1082..1148 4724..4791 139 69.1 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 911..1003 4689..4779 137 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1492..1587 4681..4778 134 61.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2790..2886 4691..4791 134 64.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6778 4738..4793 133 73.2 Plus
roo 9092 roo DM_ROO 9092bp 1111..1145 2935..2969 130 85.7 Plus
roo 9092 roo DM_ROO 9092bp 1087..1146 187..246 129 68.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6746..6799 4739..4793 128 72.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2327..2388 4738..4797 125 69.4 Plus
roo 9092 roo DM_ROO 9092bp 1084..1138 4738..4793 124 71.4 Plus
roo 9092 roo DM_ROO 9092bp 1096..1154 4720..4778 124 67.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2751..2852 146..247 122 61.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2817..2905 4691..4779 121 59.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6533..6567 4745..4779 121 82.9 Plus
roo 9092 roo DM_ROO 9092bp 1079..1137 2936..2988 120 71.2 Plus

BO24918.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:00 Download gff for BO24918.complete
Subject Subject Range Query Range Percent Splice Strand
CG17689-RA 610..6228 17..5637 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:17 Download gff for BO24918.complete
Subject Subject Range Query Range Percent Splice Strand
Spt20-RA 643..6261 17..5637 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:05 Download gff for BO24918.complete
Subject Subject Range Query Range Percent Splice Strand
Spt20-RA 643..6261 17..5637 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:05 Download gff for BO24918.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13509398..13509795 5238..5637 99   Plus
3L 13509050..13509334 4953..5237 100 -> Plus
3L 13506935..13508545 3342..4952 100 -> Plus
3L 13506640..13506871 3110..3341 100 -> Plus
3L 13504456..13506570 995..3109 100 -> Plus
3L 13503456..13504397 53..994 100 -> Plus
3L 13503349..13503384 17..52 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:17 Download gff for BO24918.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13502498..13502895 5238..5637 99   Plus
arm_3L 13502150..13502434 4953..5237 100 -> Plus
arm_3L 13500035..13501645 3342..4952 100 -> Plus
arm_3L 13499740..13499971 3110..3341 100 -> Plus
arm_3L 13497556..13499670 995..3109 100 -> Plus
arm_3L 13496556..13497497 53..994 100 -> Plus
arm_3L 13496449..13496484 17..52 100 -> Plus

BO24918.pep Sequence

Translation from 16 to 5653

> BO24918.pep
MQSLDSSCQEADFIINDTLKKLKGSSNADHVQGLAVHAHGSGVHQTQFVQ
YGTSGSSPQLQPQQSYHQLHPTLQQQQFASSSSKSYLETSLLQAIPQIPA
QPPICIFDDDESPTEGTGGSLGSLLTEPTSATPSGLPTAIAPSPSSCSSS
TTTMSNFNSITSPSPVVPDLLLSTPPGVNSSLSNSSTGAASVSSKKSEKR
PPSANSTASGGGHHLHHHHLHQTHNHHVLASPTSSPSKRQKSNSSSKESS
SSSRSSAIPAASVSTATSSSQSARAGAGAASSNSNSKPPSSVCQSGNSKF
FNLHEKIRDLYLQLLSNDLNYFAETGLKQRTRSFTLERLVDREKLNTIVV
NLYPGNKGYSLALHYDEHMVLNPQTNEWSPTDKDETSSDAAGLGTGTGSH
RSRPKPLAQDESQSKTEAGHAKHDFGLVEVLRWPYENDLLLQCIDREMLP
EFLMDLLVAETVSLSDGEGTRVYAKPSVFYAGCVIAQIRDFRQTFATSTN
ICDMKHILLRPTNATLFAEVQQMGSQLPAEDKLALESQLVLATAEPLCLE
PDPSIGRQAINSQHQRQLYNSHELRRQMKKFTQTAINRKRKLDQFTHHHG
LELCDYLARLRQRPRTGSSSGGANATPATAPTNNPLVGAMLSSFTSKVPR
RPHEVIRPIRPPTLEYPANLKVPEHVISVEKYAKAYEPLNEFSEACKDGC
QPNCRHNFQPQLVEEYILETEREASEGRRALYHIKLSIFQRPSDAEYLGE
LYVDRDYREGERNGESCRFALGTRVHANRYIQQFREIFTEEGRKAVKITH
LIPGHMPIVTHTGLTNEQRILLQQQQQQQQRQAQMQQQQQQQQQQVVVVA
NQQQQSQQQQQTQQAGQQLSATVHHVALPRQQITQKTLNLAGSNVINVQQ
NFRQQSAQQQQPQTYTIEAPQQQAAAQIVPQQQQQQQQQQQQHIHLQQLA
TGSSNTSTTTHQVSLSNGSLVLVQQQQPQQQSQQLAQALQHSGITIQPAT
IQQQQQQVKGTSVVGANSALRAQLNSNVPILQTQLKVQQQQIMQKQQQQQ
TTATSNNNNNNNNNNNMNNNTAIHPNPAINAIVNSIMNSANQYQQQQQQQ
HQQQHQQQTGNTSSNNNAAGSGGSTNNNGSSTSATTLKNSSNASILNLLN
SAPAAMTSTPVASGTFTTSTGQQQPQTLTLVQHQQQSTPNTADAATATYV
QTTRGTPTLVSTQRKQQSSEVLQNLLNANRKIGGGGTTTTTFRTNSAGNL
IAVNLNQAGQSHHQQTGDGSQTVRVSMSALASQLASPPAVMTNPTTSYTV
ISSGNSAAAAAAWIQSPTGPVQQRILSSLRRDSTTAPPNAIVVGMAAPSP
GSDSNASNASGFAVPNNLASTSSGGGGGGGALSALLTNAATPSPSGSDHS
QSSQTHQNQALLERLSNVTSNVSAVSMPHMSPQQPQPTQQFITKTIVHSP
ATSSIHSPMSSPHPQPSASPQQQQQQQQQQTTATLNLQGINLSQLQGAMA
NFAGLQNVQVQIPGFTQPISLQFSGNSLQQQQSGNTATGAGTAQGQQRSV
LVSVPVSSQQQQLPHTITLQTQSAPHHQQQHQQTQQQHAPPTGTIVSLPS
SGPGTQTVVITNNSGGGVTAGSSTSGSAGGGGGSGATTAMLTLPIAQIVG
AGVQKLNPQTIRTSNVGGGIGIAQQTVQQQTIQSQSGGNSTAAIQLLGTI
QPRARNVQVVGTKQLANRQLITTQRQIGGSTLKIATTPVNAANVVTSSAN
LTTTPIVMSAQKLQLKTVKAPVQQQQQPQQQQQQLQQQHRILNQQSTATV
SSQTLPSPNQVQVAQQQQQQQQQLQHIQIAGRATTASGAISQRTLTALAA
AKQQQQQQQAAVNRRRSTTDATKASFLDH

BO24918.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
Spt20-PD 1873 CG17689-PD 1..1873 1..1873 9489 100 Plus
Spt20-PA 1873 CG17689-PA 1..1873 1..1873 9489 100 Plus
Spt20-PC 1646 CG17689-PC 1..1645 1..1645 8389 100 Plus
ptip-PA 2294 CG32133-PA 180..1251 806..1868 391 24.1 Plus
ptip-PA 2294 CG32133-PA 863..1638 821..1610 365 26.5 Plus
Ncoa6-PC 2265 CG14023-PC 1144..2151 818..1757 338 21.7 Plus
ptip-PA 2294 CG32133-PA 1154..1618 817..1239 264 28.6 Plus
ptip-PA 2294 CG32133-PA 1001..1283 813..1133 255 32.1 Plus
Spt20-PC 1646 CG17689-PC 829..1562 1092..1859 219 21.1 Plus
ptip-PA 2294 CG32133-PA 1083..1356 817..1107 216 29.9 Plus
ptip-PA 2294 CG32133-PA 1319..1667 823..1108 181 28.8 Plus
ptip-PA 2294 CG32133-PA 1429..1730 803..1108 181 30.2 Plus
ptip-PA 2294 CG32133-PA 1309..1699 804..1135 171 26.6 Plus
ptip-PA 2294 CG32133-PA 1199..1674 815..1226 170 25.3 Plus