Clone BO24966 Report

Search the DGRC for BO24966

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:249
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG8232-RA
Protein status:BO24966.pep: Imported from assembly
Sequenced Size:3757

Clone Sequence Records

BO24966.complete Sequence

3757 bp assembled on 2010-09-16

GenBank Submission: KX799781

> BO24966.complete
GAAGTTATCAGTCGACATGGATTACGTGTATTGCGGCACCGACCCCATCG
GGGCCTCCGAAGACATACTAAGTGTTTATGACGCGGGATCTGCGCCGGGA
AACGGGCACTTTTCGCCCAGCTTCAATGGATTCAACATCGGCACCACCGA
TCCGGAATATGTGGAGCTTGTGCCCGTGCTTGCCGACGGCGGGGAGCACT
TCGGCGTTTCCAGCGTGGCGTTCGACGACTACGAAGAGCTGCTGTGGATG
GGCAACCAGGGCGGCCACGTCACATCGTACTACACAAACTCCATGCAGAA
GTACACATCCTTTCAGGTCCACGCCACCGACATTGTGCGCGACATCTCCA
CCCTGGACTCCGGAGTGCTGGCGCTCACGCAGACCTCGCTGCGTCATCAG
ATCCGCAGGGGTCTGCCCAAGTTTACCTTCAAATCGAACAACATGAAGGA
GATGGTGAGCATGCTGCAGCTATCACCGCATCGTCTGGTCATGGCCGGAC
TGCAGGACGAGCTTATCGACTTCGACCTGCGCACGCTCAAGGAAACCCGC
ATAGAGCATGTGGGTGCCGGCGGATGCACGGTGCTACGCAAGAATTCACG
TTATCTGTTTGCCGGCGACCAGCTGGGAACGGTAACGTTGCGCGACCTGA
ACAGCCTGAGTGTTCAGCACACAATCAAGACGCACACCAACATCCTTTCG
GACTTCAGTGTCCAGGGAAATCTGCTAATCTCTTGCGGCTACAGCGGAAG
GCAAAATAACCTGGCCATCGACCGCTTCCTAATGGTCTACGATCTGCGCA
TGCTGCGCCTGATCGCGCCCATTCAAGTGATGATTGATCCGCAGATGTTG
AAGTTCCTGCCATCGCTGACATCCCAACTGGCCGTCGTGTCCAGCTACGG
CCAGGTTCAGCTGGTGGACACTGTGGAGCTCAGCGAGCCGCGAGTATCCA
TGTACCAGATCAACACCAACGGCAGCCAGTGCCTCAGCTTCGACATTAGC
TCCTCTTCACAGGCCATGGCATTTGGGGACCAGTCGGGCCACATCAACAT
GATTGCCGCTGTACAAACGCCTCAGCCGCAGTTCAATCTCTACTCGCGAA
GCACAGAGTTTGCGGACGTGGTGCCACAGCTGCCGATGGTCTCCATTACG
GACACCAACTTTCCGCTATCGTCGGTCATGCTACCGCACTTGACGACGGG
CACACAATGGTTCTCAGATTGGCCGGAGGAACTGCTGCGCTACCGCTACC
ACAGGCCCAAGACCATTGATCCCGAAGTGCTGAGCAACATGAAAATGCAG
GGACCGATTGGATACTCGCCAAACCCACGCACCGCCCGTCGTAATCAAAT
TCCGTACGTGATTGAGCAGGGCGGCGTGTGCAGTCCGAACGGAAATGGAA
CTGCGGCGGCGACCAAGGCGGAGAACGGTGTGAAAATCATTCCACGGCGG
TATCGCAAAGTCGAGCTGAAGTACACGAAGCTGGGCACCCAGGACTTTGA
CTTTGACCAGCATAATCAAACATGTTTCGCGGGGCTGGAGGCAACGCTAC
CGAACTCCTACTGCAATGCTATGCTACAGATTTTGTATTTCACCGACGCG
CTTCGCGTGAAGCTGCTGGAGCATTCGTGCATCAAGGAGTTTTGCCTGTC
CTGCGAACTAGGGTTCCTCTTCAACATGCTGGATAAAAGTACCGCTTCTT
CACCTTGCCAGGCCAGCAATTTCCTGCGATCTTTCCGCACTGTGCCAGAG
GCCTCGGCACTGGGATTGATTCTCACCGACCGCTCATCGAACGTCAATCT
AATATCGCTGATACAGAACTGGAACCGATTCATTTTGCATCAAATGCATT
ACGAAATATTCGATTCTAGCAAGAACGCATCCACCTACAGCGGATCTGTG
CAAACATCAACGAACGCGGAAAACGCGGGCTCTTCAGAAACAAGTGGCTC
CTCGGACCTTTACGATTCCATAAGTGATGAGAACTCCAAGGAGGACGATC
GGGAACGCAGTAAGATCAACGCAGAAACTGACATCAGTAAGATCTTTGGG
ACCAAGCAAATCTGTATAAACCGCTGCATCAAATGCCAAGAAGAGAAGAT
AAAGGAAAGCATTCTACTTGCCTGCAATTTGTCGTATCCCAACCACATCA
AAGATAGTGATCAGTATTTCAACTTTGGCACCATTTTGAAGCGATCTCTC
AGCTCCGAGAAGAGTATTCAGGCCTTCTGCGAGAGATGTAAGAAGTTTTC
GCCAACCAATCAGAGCGTGAAGGTGACTTCGCTTCCGCAAATTCTGTCCA
TTAACTGTGGCCTCAACAACGAAAAAGACATTACCTTCCTGAAGCGCCAG
CTCAATCGCTGCAGCGAAAAGACGACTGTTGATGCGGCCGCTTCCTTGAG
CACAAGCAAGCCGTGTCGATATGGAGCCAACTGTTCGCGAAGTGACTGCC
ATTTCATGCATCCGGATCGAAAATCTCCATCGCACACAAGCCAACCGAAT
GCTGTCAACAATTCTCCCAATGGACGCCAAAAGTCCTGGTTTCCCCTTAC
ATTTACTATGGGCATCAATGACCAAGGTGAGGTGCAGGTGCAAACTCAAT
CAGATGCAAGCAGTGGCAAATCGGAACAGGAGGAGGAAACGGAAAAGCCA
CCAACAAAGGGCTTGGACAACAATCGGATGTACGCGCTGCATGCCGTGGT
GTGCCAAGTCGATGATGGTACCCAAAAGAACTTGGTATCGTTGATAAATG
TGCAGCGGCCATACCACACCATGAAACTGGCTGAATCTGCAGATGACCCT
CAGAGTCAATGGTATATTTTTAATGATTTTAGCATATCGCCCGTTTCGCC
ACAAGAATCGGTATGGTTCACATTGGATTGGAAAGTTCCTTGCATACTCT
TCTACAGACACGTAGAGGATGACTCTGAGTCTGCTAGTACTACTAGCTCG
ACCGTCACGGAAAGTGAAGAAACCATTCCATCAGAGAGCAGCAGCGGCTC
GCCAACAAATCTATCCAACCCTTTTCTAGAGGAAATTGTGAGTCCTATGC
TAGGCAACTTAAGTGCAGACGCCACGCTGCAGCCCCTGCAGTCAGATGAA
ATGCCGCAGTCGGGTGATCTGGTCGCAATGGATGCCGAGTTCGTTACCCT
AAATCCAGAGGAAAATGAGATTCGCCCGGATGGCAAAACGGCGACCATTA
AGCCATGCCACATGAGTGTGGCCCGGATTTCATGTATACGAGGACAAGGC
CCGGCTGAAGGAGTTCCATTCATGGACGATTACATATCCACCCAGGAGAA
GGTCGTGGACTACCTAACTCAGTTCTCGGGAATCAAGCCTGGCGACTTGG
ACGCTAACTTCAGCAAAAAGCGACTGACTGCCTTGAAGTACTCATACCAG
AAATTAAAATACCTCGTTGACGTAGGAGTAATATTTGTCGGACATGGTCT
GAAGAACGACTTTAGGGTCATAAACATCTATGTACCGTCGGAGCAGATAA
TAGATACGGTGCACCTGTTTCACATGCCACATCATCGCATGGTTTCCCTA
AGATTTCTAGCCTGGCATTTCTTGGGTACTAAGATTCAGTCCGAGACGCA
CGACTCCATCGAAGATGCACGGACCACTCTGCAGCTCTACAAGCACTATT
TGAAGCTGCAGGAGGAGAAGAAGTTTGCCAACGCTCTCAAGAATCTTTAC
GAACGCGGAAAGCAGCTGCAGTGGAAGGTTCCAGAGGACGCAAGCTTTCT
AGACCAT

BO24966.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
PAN2-RA 3726 CG8232-PA 1..3723 17..3739 18615 100 Plus
PAN2-RB 3723 CG8232-PB 1..3720 17..3739 18535 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
PAN2-RA 4051 CG8232-RA 132..3854 17..3739 18615 100 Plus
PAN2-RB 4048 CG8232-RB 132..3851 17..3739 18535 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8928936..8930197 433..1694 6310 100 Plus
2R 25286936 2R 8931330..8931693 2469..2832 1820 100 Plus
2R 25286936 2R 8930709..8931007 1976..2274 1495 100 Plus
2R 25286936 2R 8932290..8932513 3243..3466 1120 100 Plus
2R 25286936 2R 8932013..8932226 3030..3243 1070 100 Plus
2R 25286936 2R 8931753..8931954 2831..3032 1010 100 Plus
2R 25286936 2R 8931068..8931266 2271..2469 995 100 Plus
2R 25286936 2R 8928458..8928649 72..263 960 100 Plus
2R 25286936 2R 8928709..8928878 263..432 850 100 Plus
2R 25286936 2R 8932742..8932906 3575..3739 825 100 Plus
2R 25286936 2R 8930258..8930380 1694..1816 615 100 Plus
2R 25286936 2R 8932569..8932682 3464..3577 570 100 Plus
2R 25286936 2R 8930431..8930533 1814..1916 515 100 Plus
2R 25286936 2R 8930590..8930650 1916..1976 305 100 Plus
2R 25286936 2R 8928300..8928357 17..74 290 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:33:58 has no hits.

BO24966.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 14:16:45 Download gff for BO24966.complete
Subject Subject Range Query Range Percent Splice Strand
CG8232-RA 127..3849 17..3741 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:49 Download gff for BO24966.complete
Subject Subject Range Query Range Percent Splice Strand
CG8232-RA 132..3854 17..3741 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:13:52 Download gff for BO24966.complete
Subject Subject Range Query Range Percent Splice Strand
PAN2-RA 132..3854 17..3741 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:13:52 Download gff for BO24966.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8932743..8932906 3576..3741 98   Plus
2R 8932571..8932680 3466..3575 100 -> Plus
2R 8932291..8932512 3244..3465 100 -> Plus
2R 8932015..8932226 3032..3243 100 -> Plus
2R 8931755..8931953 2833..3031 100 -> Plus
2R 8931331..8931693 2470..2832 100 -> Plus
2R 8931070..8931266 2273..2469 100 -> Plus
2R 8930710..8931005 1977..2272 100 -> Plus
2R 8930591..8930650 1917..1976 100 -> Plus
2R 8930434..8930533 1817..1916 100 -> Plus
2R 8930259..8930380 1695..1816 100 -> Plus
2R 8928936..8930197 433..1694 100 -> Plus
2R 8928709..8928878 263..432 100 -> Plus
2R 8928458..8928648 72..262 100 -> Plus
2R 8928300..8928354 17..71 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:49 Download gff for BO24966.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4820248..4820411 3576..3741 98   Plus
arm_2R 4820076..4820185 3466..3575 100 -> Plus
arm_2R 4819796..4820017 3244..3465 100 -> Plus
arm_2R 4819520..4819731 3032..3243 100 -> Plus
arm_2R 4819260..4819458 2833..3031 100 -> Plus
arm_2R 4818836..4819198 2470..2832 100 -> Plus
arm_2R 4818575..4818771 2273..2469 100 -> Plus
arm_2R 4818215..4818510 1977..2272 100 -> Plus
arm_2R 4818096..4818155 1917..1976 100 -> Plus
arm_2R 4817939..4818038 1817..1916 100 -> Plus
arm_2R 4817764..4817885 1695..1816 100 -> Plus
arm_2R 4816441..4817702 433..1694 100 -> Plus
arm_2R 4816214..4816383 263..432 100 -> Plus
arm_2R 4815963..4816153 72..262 100 -> Plus
arm_2R 4815805..4815859 17..71 100 -> Plus

BO24966.pep Sequence

Translation from 16 to 3757

> BO24966.pep
MDYVYCGTDPIGASEDILSVYDAGSAPGNGHFSPSFNGFNIGTTDPEYVE
LVPVLADGGEHFGVSSVAFDDYEELLWMGNQGGHVTSYYTNSMQKYTSFQ
VHATDIVRDISTLDSGVLALTQTSLRHQIRRGLPKFTFKSNNMKEMVSML
QLSPHRLVMAGLQDELIDFDLRTLKETRIEHVGAGGCTVLRKNSRYLFAG
DQLGTVTLRDLNSLSVQHTIKTHTNILSDFSVQGNLLISCGYSGRQNNLA
IDRFLMVYDLRMLRLIAPIQVMIDPQMLKFLPSLTSQLAVVSSYGQVQLV
DTVELSEPRVSMYQINTNGSQCLSFDISSSSQAMAFGDQSGHINMIAAVQ
TPQPQFNLYSRSTEFADVVPQLPMVSITDTNFPLSSVMLPHLTTGTQWFS
DWPEELLRYRYHRPKTIDPEVLSNMKMQGPIGYSPNPRTARRNQIPYVIE
QGGVCSPNGNGTAAATKAENGVKIIPRRYRKVELKYTKLGTQDFDFDQHN
QTCFAGLEATLPNSYCNAMLQILYFTDALRVKLLEHSCIKEFCLSCELGF
LFNMLDKSTASSPCQASNFLRSFRTVPEASALGLILTDRSSNVNLISLIQ
NWNRFILHQMHYEIFDSSKNASTYSGSVQTSTNAENAGSSETSGSSDLYD
SISDENSKEDDRERSKINAETDISKIFGTKQICINRCIKCQEEKIKESIL
LACNLSYPNHIKDSDQYFNFGTILKRSLSSEKSIQAFCERCKKFSPTNQS
VKVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDAAASLSTSKPC
RYGANCSRSDCHFMHPDRKSPSHTSQPNAVNNSPNGRQKSWFPLTFTMGI
NDQGEVQVQTQSDASSGKSEQEEETEKPPTKGLDNNRMYALHAVVCQVDD
GTQKNLVSLINVQRPYHTMKLAESADDPQSQWYIFNDFSISPVSPQESVW
FTLDWKVPCILFYRHVEDDSESASTTSSTVTESEETIPSESSSGSPTNLS
NPFLEEIVSPMLGNLSADATLQPLQSDEMPQSGDLVAMDAEFVTLNPEEN
EIRPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYL
TQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFR
VINIYVPSEQIIDTVHLFHMPHHRMVSLRFLAWHFLGTKIQSETHDSIED
ARTTLQLYKHYLKLQEEKKFANALKNLYERGKQLQWKVPEDASFLDH

BO24966.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
PAN2-PA 1241 CG8232-PA 1..1241 1..1241 6484 100 Plus
PAN2-PB 1240 CG8232-PB 1..1240 1..1241 6463 99.8 Plus