Clone BO25164 Report

Search the DGRC for BO25164

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:251
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG31531-RA
Protein status:BO25164.pep: Imported from assembly
Sequenced Size:4150

Clone Sequence Records

BO25164.complete Sequence

4150 bp assembled on 2010-09-14

GenBank Submission: KX800080

> BO25164.complete
GAAGTTATCAGTCGACATGGAGGCCACTGATCAGGAGGTCATGCTGGAGG
GCAGGGAAGACCTCATGTCCACATCGGCGACATCGTCCACAAATGGCGGG
GACACTAATGGTTGCGGCAAAAAATTGTCCGTAACCTCTCCGGATCCCAC
ACCGTACGTGACCAAGCAGCGAGTGACGCGTCCAACGCCTCCCGCTCCTT
CAAAGAATCCGATGCAATTCGTCCAGATCAAGCCCTGCAACCTCTACCAG
ACCGCGCAGGAGCAGCTGAAGAAGGCCGAGGAGGTCAAGAAGCTGAAGGA
GGTGAAGAAGGAGGAGCCAGAGGAGTGGCAGAACAACCTTGACAATTGGA
AATCATCGAGACGAAAACGTGTCGAACACATCATCGATCGAGCGGTGGAG
ACCAAGAAACTCGAGCTGGAGGAGCATGATCGGTTGCGCCGAAAGTCGAA
AACATTCACCGAAATGATGGAGGAGAGGGCTGAAAGGGGCGGACCTCGGG
GGCGTGCCAAGCTGGCTTCCCTGGCCGTATACAACGAGGATGAGACGAAC
GACCTGAGTGATTTGGGGATCGGAACCAGCAGTGCCAGCGGAAAGAGCAG
CCTGTCCGGGGACTATGACAATAACAGTGTTATGAGCGACCATGCGGCGG
AGCTGGATAAGGCGATTGGAGCAGCTAGCTCTGTAGCTGCTGGAGTAACC
GCCCAAAACGTGGATGAGCAGCTGAATCACATAAACCGCAACGGTAGTAA
TGGGAACCACGGGAACGGAGCGGCTGTTGGCCAGACAGGACCATCAAATT
CCTCCAAGTCAGCAGGGCGGCAATACATCTCCTCGCCAGGATACGATACG
TCCTCCAGTAACGCGCAAGCCAGTTCTCCGGATCTCTGTGAATACACCTA
CGAAGGAGCCATCCAGGACTACAAGCAAAGAGTTCAACGGGCCAGCAGCA
ATGGCAATGGAAATGCCAACGGCAAGTTGATTGGAGAACATATTGCTTAT
CCCACGAGGCGAGGCTCTAAAATTGAGGATCGATTGAGTGGTTTTGAGGT
GACATCGCCAAGCGACACGCAGGAGGGTGTAGAGAAGCAAAAGGTGGACG
TGCCCAAGGTTGACATATCCAAACGCAAGGAGATCTTCGAGCAGGCCAAG
GCGGAAGTCTCAAACGGTGGTGCTCCAGCTGCCCCAAAACTCGTATTTCG
TGATGGTCTTACCAATGGAAATTCAGCTACCACTGCTCCCAAATCGGAGG
TGAGGCGTCTTTCTGGTGACATCTCCAGCATTCGAGATCGCATGCAGAGT
TTGGAACAGCAGCGGAAGGCTTTCAGTTCCAGCAAGAGTGTGGATGTGCC
GGTGCCGCCCCTTAAACAGCGTCTGAATAGTCTGCAGCAGTCCGTTGCCA
AAGAGGAGCAGAAGAAGCCACCGTTGGTGGCGCTCATCGATGCCAGACAA
CTGGAGATCATGAGGGGAGAAGAGGAACGTATGCGCCAGCAGCAACAAAA
AGAGAAGCATTCACCAAGCCAAACTACATTGTGTGCACCTAAGCCAGCTC
CTCCTGCCCTTATTATTGAGGAACCGCCGGTGGCAGACACCAACGACGAC
AGCGGCATTCAGGAGGACACCGCTGATGAACTGCAGCAGCAGCAGCAACT
CAACGCAGCCATCGCCGCCTTGGCGCTCGAGGAGCGCCAGTTGGAGGAAG
CAGCCAATGCGGTCAACCAAATTGAAGCGGAGTTCGATGAGCTGACTGAT
CTGCATCCCTCGCCATTGCCACCATCTCCAGCTCTTCCGGCGGTTCAACA
AAGCCTCCAACAACCGACAGTCGCTCAGGTTCCAGCACAAGCGGTCAATC
AGGCGGCTGCTCCTCCATTGCGGGACATGGAATTTAGTGTAAGTTGTACT
AACAATTTTATCGAACCCGCTAAGATAAGTCCTTGTGATGTTAATGTAGT
AGCTGCTTCAGCGGTGTCGGTGTCCAAATCTGGCCCCACTCCCAATCCCA
CATCCACTCCAAATATGGTATCCTCCTCTCCCAATTGTAACTTGCGTAGA
AAGCCCTCCAATGAAATGGTCCATCATCGCAATTTGCTTAAAATGTTCAA
GGAAACCTTTCAAAACGACGACGATCTGAAAGAGGTCTGCGAGATAGTCA
CTTCGCCTGGTCAGTTTACCCAGATCATTGACTTTTCCAAGCGGCCAAGT
AATCCCCCCATACCAATACCTACTCTACTACCTACCTCTACTCCGATTCC
TACCCAGATACCGCGACCACTGGGCAAGCCGCCCATGTCGCCCAAGGCTG
TGAGGTTAGCGTCCAGTCCTAAGGGACATATAAATCCTTTAAGTTCGCCC
ACGAACTCCGGGTTTTCACCCCCCCAATTCAGTATCAATGGGCGTGTGGA
GATTTTTAATTCACGGCAACTGGACAAGCCGCCCACGCCACCAGCTCCTC
CCAAGAAAACTGTAAGGAGTGAGCATCCTCTTAAGGAAGCGGTTCCTTCA
CCAGAAGTGGTGATGTGCGCTCCTCCTATGACCATCGTTGATCCCGACGA
GCTGCCCAAACCAAATACTGTAAAGGCCCTTTCAAATTGCTTCAGCCAGA
GCGATTCCAAGTCGCTAACATCACCCATAATGTCGCCGAAACCTTTGCCC
AGTGGTCGCATTCCCCAGATCACACCACCTGCTTCTCCAAAGCCCCCGAA
ACGAGTTCAGCTTGACGAGGTGGATCGTAGCTCTGGGGACTATGCCCCAG
TTGTTGGTCAAACCAAGGCAATTGTACACACGCCCCCTAGCAAAATAAAT
GCCCGGGCAAACCAAACTCTTGATCCCCTAGCACCCAACGACTCACTGTG
CCTGCACACATCTTCGCCCAGCGAGATACCTTCCTTGAAAGCCTGCTCCC
CGAATGAATCCAGTTTGTTCAAGCTGGCTTCGTCACGACCCACCTCGCCT
TCAGTGGATGTGGCTTCGTGTCAGAAATTTTTGAATAGAGAAGCACCAAA
GGATATCCAACTGGCCGAAGAAGACCGCAAGAGAATGGATCAGTTTGCTG
TGGAGGAGATGCCCTGTGATAAGATCGATGTGACCAAATCACCCCAGCCC
AATACTGGTTTCCAGATTGTGACCGAGGATCTAGTAAAAAAATGTGATGG
CAAAAACATATCCGAAGCGGTAAGGGATCTAGACGTCCCACCCAGCCAAG
AAGATATTGCCCTGTGTGCGGGACTACTAGACTGTTTGGCTCCAGCTCAG
GAGCCTATTTGTGACAGCATCGATGTGAGGAATGGTCCAGTGCCGGCAAC
TGGATTTCAGGACATCAGTGAGGAGGAGGTGAAAAAGTGTGAAAAGCATA
ATAAAAATTATGTTATCACAAACAGGCCAAGCTCACCCATTGGCAGTGTC
AGAGCAGCTCACTCGAAGGCTTTGATGGACACTTGTGAGCAGATCATTGC
AGAGGAGCGCAAAGCTAGCAGTCAGATGATGAAGACTTCGCTGCCGGAGT
CGGTGGAGAAACCGTCGACACCCCTCCCAGGTCGCAAATCCAAGATTCCC
ATACCCAAGCCTTGCTGTATTTCGGCATCTGGAACTGATTCAATAAGTAG
AGCGGGCTATGTACCAACTGCACCGTCACACCTCTCAGGAAGTGCCCAGC
AGCCGTTAATAGCACGCACCCATGTGGTGGAAACAGAGATCAAGGTCAAG
GAGATCTCCCCACCCAGTATACCTAAGACACCGGAACAAACTCAGCTCCA
TGCATCACCAACTAAGGAGAAGAAAGCCAAGAACATATTTGATTTCCTGC
GCAGAAACTTTGGGCATCAGGAAGAGCCGCAGCATCATTCCACTCTGAAT
GAGACCCTTGAGAAAAAGGTGGTGCTCACCAGCACCAAGAGTGGAGTAGA
TGTGGTCAATGCCGATGAGTTTGTTCGGGTAGACAATTCAAAGTTCTATT
TGGCAAGTGAGCTGGAGGACGTACCAGTGCCACCTCCTCTGCCCAAGACA
CCTGCTCCTGTCAACATTGAGATTCGAAAAAAGATCACTACAAATGAGAT
ATTAGAGGAAAATACAACAGAACAGGCGTTAACCCAGGAAATAAGCGATT
TGCTAGACGACGAGATCATGAAACTGGAGAATGCAAGCTTTCTAGACCAT

BO25164.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-RG 4119 CG43427-PG 1..4116 17..4132 20580 100 Plus
CG43427-RF 4119 CG43427-PF 1..4116 17..4132 20580 100 Plus
CG43427-RE 4119 CG43427-PE 1..4116 17..4132 20580 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-RG 5552 CG43427-RG 831..4946 17..4132 20580 100 Plus
CG43427-RF 5897 CG43427-RF 1176..5291 17..4132 20580 100 Plus
CG43427-RE 5335 CG43427-RE 614..4729 17..4132 20580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4701157..4704655 634..4132 17495 100 Plus
3R 32079331 3R 4698048..4698255 127..334 1040 100 Plus
3R 32079331 3R 4700169..4700327 476..634 795 100 Plus
3R 32079331 3R 4699717..4699860 335..478 720 100 Plus
3R 32079331 3R 4697432..4697542 17..127 555 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:24:41 has no hits.

BO25164.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:59 Download gff for BO25164.complete
Subject Subject Range Query Range Percent Splice Strand
CG31531-RC 827..4942 17..4134 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:23 Download gff for BO25164.complete
Subject Subject Range Query Range Percent Splice Strand
CG43427-RE 614..4729 17..4134 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:10:37 Download gff for BO25164.complete
Subject Subject Range Query Range Percent Splice Strand
CG43427-RE 614..4729 17..4134 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:10:37 Download gff for BO25164.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4701158..4704655 635..4134 99   Plus
3R 4700171..4700327 478..634 100 -> Plus
3R 4699717..4699859 335..477 100 -> Plus
3R 4698049..4698255 128..334 100 -> Plus
3R 4697432..4697542 17..127 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:23 Download gff for BO25164.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 526880..530377 635..4134 99   Plus
arm_3R 525893..526049 478..634 100 -> Plus
arm_3R 525439..525581 335..477 100 -> Plus
arm_3R 523771..523977 128..334 100 -> Plus
arm_3R 523154..523264 17..127 100 -> Plus

BO25164.pep Sequence

Translation from 16 to 4150

> BO25164.pep
MEATDQEVMLEGREDLMSTSATSSTNGGDTNGCGKKLSVTSPDPTPYVTK
QRVTRPTPPAPSKNPMQFVQIKPCNLYQTAQEQLKKAEEVKKLKEVKKEE
PEEWQNNLDNWKSSRRKRVEHIIDRAVETKKLELEEHDRLRRKSKTFTEM
MEERAERGGPRGRAKLASLAVYNEDETNDLSDLGIGTSSASGKSSLSGDY
DNNSVMSDHAAELDKAIGAASSVAAGVTAQNVDEQLNHINRNGSNGNHGN
GAAVGQTGPSNSSKSAGRQYISSPGYDTSSSNAQASSPDLCEYTYEGAIQ
DYKQRVQRASSNGNGNANGKLIGEHIAYPTRRGSKIEDRLSGFEVTSPSD
TQEGVEKQKVDVPKVDISKRKEIFEQAKAEVSNGGAPAAPKLVFRDGLTN
GNSATTAPKSEVRRLSGDISSIRDRMQSLEQQRKAFSSSKSVDVPVPPLK
QRLNSLQQSVAKEEQKKPPLVALIDARQLEIMRGEEERMRQQQQKEKHSP
SQTTLCAPKPAPPALIIEEPPVADTNDDSGIQEDTADELQQQQQLNAAIA
ALALEERQLEEAANAVNQIEAEFDELTDLHPSPLPPSPALPAVQQSLQQP
TVAQVPAQAVNQAAAPPLRDMEFSVSCTNNFIEPAKISPCDVNVVAASAV
SVSKSGPTPNPTSTPNMVSSSPNCNLRRKPSNEMVHHRNLLKMFKETFQN
DDDLKEVCEIVTSPGQFTQIIDFSKRPSNPPIPIPTLLPTSTPIPTQIPR
PLGKPPMSPKAVRLASSPKGHINPLSSPTNSGFSPPQFSINGRVEIFNSR
QLDKPPTPPAPPKKTVRSEHPLKEAVPSPEVVMCAPPMTIVDPDELPKPN
TVKALSNCFSQSDSKSLTSPIMSPKPLPSGRIPQITPPASPKPPKRVQLD
EVDRSSGDYAPVVGQTKAIVHTPPSKINARANQTLDPLAPNDSLCLHTSS
PSEIPSLKACSPNESSLFKLASSRPTSPSVDVASCQKFLNREAPKDIQLA
EEDRKRMDQFAVEEMPCDKIDVTKSPQPNTGFQIVTEDLVKKCDGKNISE
AVRDLDVPPSQEDIALCAGLLDCLAPAQEPICDSIDVRNGPVPATGFQDI
SEEEVKKCEKHNKNYVITNRPSSPIGSVRAAHSKALMDTCEQIIAEERKA
SSQMMKTSLPESVEKPSTPLPGRKSKIPIPKPCCISASGTDSISRAGYVP
TAPSHLSGSAQQPLIARTHVVETEIKVKEISPPSIPKTPEQTQLHASPTK
EKKAKNIFDFLRRNFGHQEEPQHHSTLNETLEKKVVLTSTKSGVDVVNAD
EFVRVDNSKFYLASELEDVPVPPPLPKTPAPVNIEIRKKITTNEILEENT
TEQALTQEISDLLDDEIMKLENASFLDH

BO25164.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:29:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG43427-PG 1372 CG43427-PG 1..1372 1..1372 7065 100 Plus
CG43427-PF 1372 CG43427-PF 1..1372 1..1372 7065 100 Plus
CG43427-PE 1372 CG43427-PE 1..1372 1..1372 7065 100 Plus
CG43427-PH 1493 CG43427-PH 1..626 1..626 3171 99.7 Plus
CG43427-PP 1501 CG43427-PP 1..626 1..626 3171 99.7 Plus