Clone BO26701 Report

Search the DGRC for BO26701

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptCG13643-RA
Protein status:BO26701.pep: Imported from assembly
Sequenced Size:2455

Clone Sequence Records

BO26701.complete Sequence

2455 bp assembled on 2010-09-16

GenBank Submission: KX795426

> BO26701.complete
GAAGTTATCAGTCGACATGCTGAGCATTATAAATGCAATGATTGCCTTCC
TCCTGGCAACGACACTTTGCAGTGGATACGGATACGCGCAGGCCCAGTTG
CTCGACGAGGACGACGACCTGGCCTTCGGAAGGCCCTGGCCCACCTACAG
CCTACAGAACATGCCCAAGACGCAGTTCACCTGCCACGACAAGATCCTGG
GTGGCTACTATGCCGATCCGGAGACCCAGTGCCAGATGTTCCACGTCTGC
GTCAAGCTGCCCGGAGTGGGGGTGCAGGACTATCGATTCCTCTGTCCCAA
CACAACGGCCTTCGACCAGGAGCTGCAAATCTGCGCCAATTGGTTGGATG
TGGACTGCGACAAGGCAACCTCCTTCTACGACAATGGCCACCTCAACGAT
CTATATCGCAACGGAGACGAGAGCAAATCTGCCAACGAAGAGGAGGCAAC
CTTCCACCTTCAACGCGCCGAAACGGGCGATATACGTCGCTCTAAGGAGA
ACCACAATAATAACAATATTAACAACAATCGTGGAGCGGACCAAAAACCA
CGCCATCGCCACAATTATGCCCAGACAGGTGGCAGCTCTAGTTCCAGCTC
CAGTCCCAAATTGGAGATCACGCAATCCACCAAGCGACCCATTTCCACCT
ATTACACGCCGACCACTTTGGGCAGCACCACCACATCCACTACATCGACC
ACAACCACGACGGAACGCAGCTATTACAACAATAATTACAACAACAATTA
CAGCAACAATGACGACTCGAAGCAAGATTTAGACGATATCTTCAAGGGTT
CACACAGCTCGCACTTCTTCTCCAACCGCCACGGGGGTCGGGAATACGAC
GAGGAACCCAGCCGGCCCAAGCCCAACGACTTTTCGGATTACCAGCGCAA
GACGACCCGGGTCACGCCCACGCGCGGTGTTCAACGTCCAACTTCCGGTT
CGAGTAGTCCGATTCCATCCAGCACCGCTGCTCCCAGCACGACCAAGTCC
CTGAAGAAGATCACCCTGCATGCCACCTTCAACACGGACTTCCTGGATAG
CTCTTCGCATACCAAGAGTCCATCTTACAGCGCGGTCACCACTCCGCGGC
CCAGCAGCAGCATCACCAGTCGCTTCAGCTTCGGTTCCAATGACTTTTCC
ACCCAGGAAAGGATTCAGCCGACCACCTATAATCCCAATAACGGTGCCTA
TCGCTTCAAGACCACCTCGCCACCCGCCAGTTCCACAAAGGTGACGGGTA
AGGGAGTCCAGGACTTTGAGAAGCGTAGCAAGCCTACATCGGCGGCTGTG
CGGAAACAGAAGCTGGGTCCCCAGGAGTCCAACTTCATCAACCAAAACGA
GTTTGTGGATTTATCGAAAAGCACCAAGCTGCAGCAGCCACAACCCTTCC
AGGTGGCCCAGACTAAGCCCAACCAATTGGAACCACATTACCAGCGACAC
AAGCCACAGGTGACCCGAGTTGGTGGCCAGGAGCCAGCTCCCTTCTCCGC
ACCAAGTTCCAAGCCGCGTTCCTTCACCAGCCGTGGAAGCATCACCTACA
AGGCCACCACCGAGCGTTATGTTGACCAAGAGCTGTACTATCCCACCACC
AGTTCCACAACCAGGGCCAAGGAGGCCTACACACCCACAACCTTCCGGCC
TACCACCTATAAGAAACCGTACGAGCAGAGCTATCAGAGTCAGCAAACCC
ATCGACCCACCCAGGCGGCCACCAAAAAGGCGGCACATTCGGTGACCTCA
GCTCCACCCACTACCACCAATCCGCATGCCAATGTGGATGAGGACGATGG
ACAGTACCATCCGGAGCTGTACGAAAACGACTTCCCTCGCAATCGCATCC
GGTTCCTGCGCAACCGATCCACCAGCTCGACTACCTCGACCACAAGTGCT
CCGGTGGTTTCCAGCAGACAACCACATGGCTTTCAGCAGGCACATCATCA
TCTGAAGAGCCAACAGCAATCCGTCTACCAAAAGGAGCGTGAGCGGGAAC
GGGAACGTGAGCGGGAATCAGACCTCAGCGACGAGGATGAGCTCTTCAAG
ACCGCTCAGTCACTGAACTTTGGAGCGGCCAGCATTAACAAATTGAGGGC
GGACATCTACAAGGCGGAGAAGACCTCACAGCAGTACAACTCGCAGTACA
GTCCGCAGCTGGCATCTAGTCCGCAGGCCAGCAGTAGCAGCAGCAGCAGC
ACTAGCACCACCAGTACCACAACTAGCACCACCACGACCACCACTCGACG
TCCTCCGACCACTGTCAGAACCACCACTACCACCTTTACAACAAGTGCAC
CACCCGTGGAGACCAAGAAGTCGGTTAAGAGCAAAAAGGAGCAGCAGCAG
CTGGAGAAGAAGGACCGTCCAGCTGGCAAGAGGCCACCGCATGCAGACGA
GGACACCAGCTACGATTACGCCTACTACGACACGGACGCAAGCTTTCTAG
ACCAT

BO26701.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13643-RC 2424 CG13643-PC 1..2421 17..2437 12105 100 Plus
CG13643-RB 2424 CG13643-PB 1..2421 17..2437 12105 100 Plus
CG13643-RE 2421 CG13643-PE 1..2418 17..2437 12025 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13643-RC 3068 CG13643-RC 195..2617 15..2437 12115 100 Plus
CG13643-RB 3248 CG13643-RB 375..2797 15..2437 12115 100 Plus
CG13643-RE 3065 CG13643-RE 195..2614 15..2437 12035 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24898136..24899799 2437..774 8320 100 Minus
3R 32079331 3R 24899861..24900158 773..476 1490 100 Minus
3R 32079331 3R 24903207..24903425 274..56 1095 100 Minus
3R 32079331 3R 24900281..24900487 477..271 1035 100 Minus
3R 32079331 3R 24905339..24905380 56..15 210 100 Minus
Blast to na_te.dros performed 2014-11-28 05:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2583..2684 673..775 133 67.6 Plus
Stalker4 7359 Stalker4 STALKER4 7359bp 2849..2908 693..753 131 70.5 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3588..3628 730..770 115 75.6 Plus

BO26701.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-17 10:26:21 Download gff for BO26701.complete
Subject Subject Range Query Range Percent Splice Strand
CG13643-RA 194..2614 17..2439 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:53 Download gff for BO26701.complete
Subject Subject Range Query Range Percent Splice Strand
CG13643-RB 377..2797 17..2439 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:14:13 Download gff for BO26701.complete
Subject Subject Range Query Range Percent Splice Strand
CG13643-RB 377..2797 17..2439 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:14:13 Download gff for BO26701.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24905339..24905378 17..56 100   Minus
3R 24903210..24903424 57..271 100 <- Minus
3R 24900282..24900486 272..476 100 <- Minus
3R 24899861..24900157 477..773 100 <- Minus
3R 24898133..24899799 774..2439 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:53 Download gff for BO26701.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20731061..20731100 17..56 100   Minus
arm_3R 20728932..20729146 57..271 100 <- Minus
arm_3R 20726004..20726208 272..476 100 <- Minus
arm_3R 20725583..20725879 477..773 100 <- Minus
arm_3R 20723855..20725521 774..2439 99 <- Minus

BO26701.pep Sequence

Translation from 16 to 2455

> BO26701.pep
MLSIINAMIAFLLATTLCSGYGYAQAQLLDEDDDLAFGRPWPTYSLQNMP
KTQFTCHDKILGGYYADPETQCQMFHVCVKLPGVGVQDYRFLCPNTTAFD
QELQICANWLDVDCDKATSFYDNGHLNDLYRNGDESKSANEEEATFHLQR
AETGDIRRSKENHNNNNINNNRGADQKPRHRHNYAQTGGSSSSSSSPKLE
ITQSTKRPISTYYTPTTLGSTTTSTTSTTTTTERSYYNNNYNNNYSNNDD
SKQDLDDIFKGSHSSHFFSNRHGGREYDEEPSRPKPNDFSDYQRKTTRVT
PTRGVQRPTSGSSSPIPSSTAAPSTTKSLKKITLHATFNTDFLDSSSHTK
SPSYSAVTTPRPSSSITSRFSFGSNDFSTQERIQPTTYNPNNGAYRFKTT
SPPASSTKVTGKGVQDFEKRSKPTSAAVRKQKLGPQESNFINQNEFVDLS
KSTKLQQPQPFQVAQTKPNQLEPHYQRHKPQVTRVGGQEPAPFSAPSSKP
RSFTSRGSITYKATTERYVDQELYYPTTSSTTRAKEAYTPTTFRPTTYKK
PYEQSYQSQQTHRPTQAATKKAAHSVTSAPPTTTNPHANVDEDDGQYHPE
LYENDFPRNRIRFLRNRSTSSTTSTTSAPVVSSRQPHGFQQAHHHLKSQQ
QSVYQKERERERERERESDLSDEDELFKTAQSLNFGAASINKLRADIYKA
EKTSQQYNSQYSPQLASSPQASSSSSSSTSTTSTTTSTTTTTTRRPPTTV
RTTTTTFTTSAPPVETKKSVKSKKEQQQLEKKDRPAGKRPPHADEDTSYD
YAYYDTDASFLDH

BO26701.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG13643-PC 807 CG13643-PC 1..807 1..807 4258 100 Plus
CG13643-PB 807 CG13643-PB 1..807 1..807 4258 100 Plus
CG13643-PE 806 CG13643-PE 1..806 1..807 4235 99.8 Plus
CG13643-PD 819 CG13643-PD 1..819 1..807 4235 98.5 Plus
Muc30E-PC 1702 CG33300-PC 661..1226 187..782 229 21.6 Plus