Clone BO26703 Report

Search the DGRC for BO26703

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:3
Vector:pDNR-Dual
Associated Gene/Transcriptvari-RD
Protein status:BO26703.pep: Imported from assembly
Sequenced Size:1879

Clone Sequence Records

BO26703.complete Sequence

1879 bp assembled on 2010-09-13

GenBank Submission: KX793784

> BO26703.complete
GAAGTTATCAGTCGACATGGTTCGGTGGAGCGCGCGGTCGCGGCGCCAAG
CTCGCCAGGATAAAGTGGAGCTATTGGCCAGAAACAACAAAGTGAATGGC
GAGGACGATACCTCCGATAACGCCGCCTTTCGCAACTCGACTGACCTATC
CGACCACGATGAGATCTTCCTCAAGGGATTGCTGCGTAGTAACTCCAACA
CGCCCCACAAGGAACTGATGCTGAATCCGACCGAGCCGCAGCCAGTGCCA
CTATTCCTGCCCGCTCATCTGAACAACAAGCCCATCTGCGACGACATCAT
CCGCAAGTTCTCACCCTCGAGGCGCCTGGAGTCGCGAGAACTCGCCAAGC
TTCTCGCCCAGCCGCATTTTCGTGCTCTTTTGCGCGCCCATGATGAGATA
GGAGCACTCTACGAGCAACGACTTAAAGCTGCCGGGGGATCCACCAGCCA
ACTAGAGATCGCCAGCCAACGCCAAACGGGAGGCTACCTGTTCACCGAGG
ACGTCCTCAACACCAAGATGCCAGTGGAGACCATCAAGATGGTGGGTCTG
CGCCGAGATCCCAGCAAGCCGCTGGGCCTGACCGTCGAACTGGACGAATT
CAAGCAGCTGGTCGTGGCCAGGATTCTGGCGGGCGGGGTGATCGACAAAC
AGAGCATGCTGCACGTTGGCGATGTCATCCTAGAGGTGAACGGTACGCCC
GTTCGCACTCCCGATGAGCTGCAGGTGGAGGTGTCGCGGGCCAAGGAGAA
TCTCACCCTCAAGATCGGGCCGAACGTGGACGAGGAGATCAAGAGCGGTC
GCTATACTTGCTACATGCGTGCCCTTTTCACATACAATCCATCCGAAGAT
TCCTTGCTGCCATGCAGGGATATTGGATTGCCCTTCAAGTCGGGCGACAT
TTTGCAGATCATCAACGTAAAGGATCCCAACTGGTGGCAGGCCAAGAACA
TTACTGCCGAATCTGACAAAATTGGACTCATACCATCCCAAGAGCTGGAG
GAGCGGCGCAAAGCCTTCGTGGCCCCCGAGGCGGACTACGTTCACAAGAT
TGGCATTTGCGGAACAAGAATCTCGAAGCGAAAGCGCAAGACCATGTACC
GATCTGTGGCCAATTGCGAGTTCGACAAGGCGGAGCTGCTGCTCTATGAG
GAGGTCACGCGGATGCCGCCGTTCCGCAGGAAAACCCTGGTTCTCATCGG
TGTTTCCGGTGTGGGAAGACGTACGCTCAAGAATCGGCTGATCAACAGCG
ATGTGGACAAGTTCGGAGCGGTCATTCCACATACCAGTCGCCCCAAGCGC
GCCTTGGAGGAGAACGGCAGTAGCTACTGGTTCATGGACCGCGAGGAAAT
GGAAGAGGCCGTGCGGAACAACGAGTTCCTGGAGTACGGCGAGCACAATG
GCAATCTGTACGGCACGCATTTGCAGTCCATCAAGGATGTGATCAACAGT
GGGCGCATGTGCATCCTGGATTGTGCACCGAATGCCCTGAAGATCCTGCA
CAACAGCCAGGAACTGATGCCTTTTGTCATCTTTGTGGCAGCGCCTGGCA
TGGAGCAGCTCAAGACCATCTATGCGGATCGCAGGGCCACGGGCTCCAAC
CGGAATTTATCTTTTGATCGCCAGAGTTCCATAAGATTCAGCTCCAGACG
CGCCCGTACGCTCGAGTCCCTAGCGTCGTTGTATGAGGACGACGACCTTG
TCGCCACCGTCGAGGAGAGCAGCTTCGTCCAGCGCAAGTATGAGAAATAC
TTCGACATGGTCATCGTGAACGAGGACTTCGATGAGACGTTCCGCCAGGT
GGTGGAAACGCTGGATCAGATGAGCCACGAGGAGCAGTGGGTGCCTGTCA
ACTGGATCTACGCAAGCTTTCTAGACCAT

BO26703.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
vari-RD 1848 CG9326-PD 1..1845 17..1861 9195 99.9 Plus
vari-RF 1410 CG9326-PF 355..1407 809..1861 5250 99.9 Plus
vari-RC 1410 CG9326-PC 355..1407 809..1861 5250 99.9 Plus
vari-RF 1410 CG9326-PF 1..291 518..808 1455 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
vari-RD 2717 CG9326-RD 285..2129 17..1861 9195 99.9 Plus
vari-RF 2379 CG9326-RF 739..1791 809..1861 5250 99.9 Plus
vari-RC 2320 CG9326-RC 680..1732 809..1861 5250 99.9 Plus
vari-RF 2379 CG9326-RF 88..675 221..808 2925 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20791230..20791664 808..374 2175 100 Minus
2L 23513712 2L 20789721..20790052 1612..1281 1660 100 Minus
2L 23513712 2L 20790125..20790335 1280..1070 1040 99.5 Minus
2L 23513712 2L 20789250..20789425 1861..1686 880 100 Minus
2L 23513712 2L 20790391..20790558 1069..902 840 100 Minus
2L 23513712 2L 20792113..20792267 374..220 760 99.4 Minus
2L 23513712 2L 20796653..20796758 122..17 530 100 Minus
2L 23513712 2L 20790622..20790720 907..809 495 100 Minus
2L 23513712 2L 20796037..20796135 220..122 495 100 Minus
2L 23513712 2L 20789585..20789660 1688..1613 380 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:59:41 has no hits.

BO26703.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:10 Download gff for BO26703.complete
Subject Subject Range Query Range Percent Splice Strand
vari-RD 283..2127 17..1863 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:24 Download gff for BO26703.complete
Subject Subject Range Query Range Percent Splice Strand
vari-RD 285..2129 17..1863 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:46 Download gff for BO26703.complete
Subject Subject Range Query Range Percent Splice Strand
vari-RD 285..2129 17..1863 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:46 Download gff for BO26703.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20796653..20796758 17..122 100   Minus
2L 20796037..20796134 123..220 100 <- Minus
2L 20792114..20792266 221..373 99 <- Minus
2L 20791230..20791664 374..808 100 <- Minus
2L 20790622..20790720 809..907 100 <- Minus
2L 20790391..20790552 908..1069 100 <- Minus
2L 20790125..20790335 1070..1280 99 <- Minus
2L 20789721..20790052 1281..1612 100 <- Minus
2L 20789586..20789660 1613..1687 100 <- Minus
2L 20789248..20789423 1688..1863 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:24 Download gff for BO26703.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20796653..20796758 17..122 100   Minus
arm_2L 20796037..20796134 123..220 100 <- Minus
arm_2L 20792114..20792266 221..373 99 <- Minus
arm_2L 20791230..20791664 374..808 100 <- Minus
arm_2L 20790622..20790720 809..907 100 <- Minus
arm_2L 20790391..20790552 908..1069 100 <- Minus
arm_2L 20790125..20790335 1070..1280 99 <- Minus
arm_2L 20789721..20790052 1281..1612 100 <- Minus
arm_2L 20789586..20789660 1613..1687 100 <- Minus
arm_2L 20789248..20789423 1688..1863 98 <- Minus

BO26703.pep Sequence

Translation from 16 to 1879

> BO26703.pep
MVRWSARSRRQARQDKVELLARNNKVNGEDDTSDNAAFRNSTDLSDHDEI
FLKGLLRSNSNTPHKELMLNPTEPQPVPLFLPAHLNNKPICDDIIRKFSP
SRRLESRELAKLLAQPHFRALLRAHDEIGALYEQRLKAAGGSTSQLEIAS
QRQTGGYLFTEDVLNTKMPVETIKMVGLRRDPSKPLGLTVELDEFKQLVV
ARILAGGVIDKQSMLHVGDVILEVNGTPVRTPDELQVEVSRAKENLTLKI
GPNVDEEIKSGRYTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIIN
VKDPNWWQAKNITAESDKIGLIPSQELEERRKAFVAPEADYVHKIGICGT
RISKRKRKTMYRSVANCEFDKAELLLYEEVTRMPPFRRKTLVLIGVSGVG
RRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVR
NNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQEL
MPFVIFVAAPGMEQLKTIYADRRATGSNRNLSFDRQSSIRFSSRRARTLE
SLASLYEDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLD
QMSHEEQWVPVNWIYASFLDH

BO26703.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
vari-PD 615 CG9326-PD 1..615 1..615 3173 100 Plus
vari-PB 636 CG9326-PB 1..636 1..615 3141 96.7 Plus
vari-PE 611 CG9326-PE 1..611 1..615 2987 92.8 Plus
vari-PF 469 CG9326-PF 1..469 168..615 2284 95.5 Plus
vari-PC 469 CG9326-PC 1..469 168..615 2284 95.5 Plus