Clone BO26711 Report

Search the DGRC for BO26711

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:11
Vector:pDNR-Dual
Associated Gene/TranscriptCG8910-RA
Protein status:BO26711.pep: Imported from assembly
Sequenced Size:1858

Clone Sequence Records

BO26711.complete Sequence

1858 bp assembled on 2010-10-15

GenBank Submission: KX796443

> BO26711.complete
GAAGTTATCAGTCGACATGCCCTTCGGCCGCAAGTCCCCGCTGGAGGCAC
TGGCCCTTCCCGGCGTCATGCTCGCCTACAAGTACAGCCAGTTCCGCCAG
CGCCGCCGGGAGGCCGCCAGCCGACGGGTCACCGAGCGCGAACTCTCGGC
GCTGCACCATAAAATCGACAAACTACTGAGTAAACTGGAGGAGGAAAGCG
AGCCGGATCCTCCAACCTCCCAGGAGGACGAATGTGTGATCTGCATCAAT
GCCCGGGCCACCATGCAGACATCGCCATGTGGCCACCGCGTCGTCTGCCG
CCGCTGCTTTGTGAAGACCATTCAGAGTGCGGTGGCCCAACGACTGTTGC
CCCTTCGCTGCGTCATTTGTCGAGCGCGGGTCAATCGTCTGACCTCGTCC
TCGGGCACTTGGCGAATCCAGGAGTCGGCCAGCAGCTACTCAATGGGCGC
CAAGAGTTGGGCCTCCGCCGGAGTGGCCGCCGGCGGTGTGGTACCCTCGG
CGAGCTCCTACTCGATGAACGATGCGCACAGCGGCCACCATTCGTTCCAC
CAGCCCACGCTGCACAAGTCGGCGGTGGGACGGCATCACCCGCATCATTA
CGCCGCCCGAGGATCAGCCCATGCTCGAGTCTCCCAGTCGGACAGCCTGT
ACTCGATGAGCTCGACGGGATCGGCGGCTTCATCGGCCTCCGGTTATTCA
CACTACTCCAAGACGTCTTCCATATCGAGCAACGGTCCCTGCTCACCGGC
CTCGCCGGCCGTGGCTTCCAGCTCCAATCACCTGGCACCGCCATCGCCCA
CCACCCACCATCACAGTCATAGTCTGGCCTCACCCACTCCATCGGGATCA
TCGGGCAGTTCCCTTTCACCGCGGGAAAATGGAACTTCACATTCGCATCA
TGGTGGGTGTCCCATTGGTTGCTCCGGTGCCGTGCCAAGAAAACCGCTTC
ACACGCTCACCAATAGCTCATCCACGCCCATTTCCGGTTCATCGTCGAGC
GGAAGTGGGGGAGGAGGAGTGGGCAACGGCAACGGTAGTGTACCAAGTGG
AATGATGACGCCTACGCATACGTATCCTGGCCGAAGGCATGTAAAGAACC
GACTGATGGACATCCAGAACCGCCTGCCGCCGATCAAGGAGTTCCGCAGT
CCGGCCAAAGTGCCGCATCCTTCGCCCGTGCACGTCAGCAATCCCAGATT
TCGTTACTCCACTTATACAAAGTCCAGTGCCCATGAACTGGCTCCGTTGC
TGCGTGAATCCGGATCGTCGCCTCCGCCACGTCGCCCCAGTCCGATGAAC
ATCCAGCTGAGCTGCTCCGCACTGGCCCCGCCCCCTTTGAAGGCGGGCGG
GGCAAAGATCTGCCCACTGACCTCGAAGAACTCGCTGCCGAAAAACGCTT
ACGTGATGCCCAAGGATAAGAAGCAGCCAGCTTCTGTTCCGCAAGGGAAA
GCTACTGGTACTGCCTCCAAGTCGACTCCACAAGGAGCAGGCTGCTCGAG
GGCATCAGCTGGATGTTCTGCTGCCAATTCAGGATCAACTGGAGCTGGAT
CGGCTAGTAATCCCAAGCCCTCGTCAAGCTCTTCCAGTCGCAGTTTTCCG
CTTTTCTCCGCCGCCAGTAATCAGAGAGAGAAGGCTGACAATAAGAAGAA
CGAATCTGTTGAGCGCAAGAAAAAGGAGGAAAAGCTCAAGCTGAAGGCTG
AGAAGGAAGCCAGAAAGGAGGAAAAGCGACTGGCCAAGGAGGAGGAGCGT
CTGGCCAAGCTGCACGCCAAGGAGGAGAAGAAGCGGGGCAAGAAGGAGGC
CAAGGAGCTGCTGTTGGCCAACGATGGGAACAGCAAGAAGGCAAGCTTTC
TAGACCAT

BO26711.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8910-RA 1827 CG8910-PA 1..1824 17..1840 9120 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG8910-RA 3406 CG8910-RA 448..2271 17..1840 9120 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16877001..16878037 1203..167 5185 100 Minus
2R 25286936 2R 16876505..16876932 1630..1203 2125 99.8 Minus
2R 25286936 2R 16894119..16894269 167..17 755 100 Minus
2R 25286936 2R 16875859..16875983 1840..1716 625 100 Minus
2R 25286936 2R 16876341..16876433 1718..1626 465 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:03:10 has no hits.

BO26711.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:03 Download gff for BO26711.complete
Subject Subject Range Query Range Percent Splice Strand
CG8910-RA 447..2270 17..1842 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:27 Download gff for BO26711.complete
Subject Subject Range Query Range Percent Splice Strand
CG8910-RA 448..2271 17..1842 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:26 Download gff for BO26711.complete
Subject Subject Range Query Range Percent Splice Strand
CG8910-RA 448..2271 17..1842 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:26 Download gff for BO26711.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16894120..16894269 17..166 100   Minus
2R 16877001..16878037 167..1203 100 <- Minus
2R 16876510..16876931 1204..1625 100 <- Minus
2R 16876342..16876433 1626..1717 100 <- Minus
2R 16875856..16875981 1718..1842 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:27 Download gff for BO26711.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12781625..12781774 17..166 100   Minus
arm_2R 12764506..12765542 167..1203 100 <- Minus
arm_2R 12764015..12764436 1204..1625 100 <- Minus
arm_2R 12763847..12763938 1626..1717 100 <- Minus
arm_2R 12763361..12763486 1718..1842 98 <- Minus

BO26711.pep Sequence

Translation from 16 to 1858

> BO26711.pep
MPFGRKSPLEALALPGVMLAYKYSQFRQRRREAASRRVTERELSALHHKI
DKLLSKLEEESEPDPPTSQEDECVICINARATMQTSPCGHRVVCRRCFVK
TIQSAVAQRLLPLRCVICRARVNRLTSSSGTWRIQESASSYSMGAKSWAS
AGVAAGGVVPSASSYSMNDAHSGHHSFHQPTLHKSAVGRHHPHHYAARGS
AHARVSQSDSLYSMSSTGSAASSASGYSHYSKTSSISSNGPCSPASPAVA
SSSNHLAPPSPTTHHHSHSLASPTPSGSSGSSLSPRENGTSHSHHGGCPI
GCSGAVPRKPLHTLTNSSSTPISGSSSSGSGGGGVGNGNGSVPSGMMTPT
HTYPGRRHVKNRLMDIQNRLPPIKEFRSPAKVPHPSPVHVSNPRFRYSTY
TKSSAHELAPLLRESGSSPPPRRPSPMNIQLSCSALAPPPLKAGGAKICP
LTSKNSLPKNAYVMPKDKKQPASVPQGKATGTASKSTPQGAGCSRASAGC
SAANSGSTGAGSASNPKPSSSSSSRSFPLFSAASNQREKADNKKNESVER
KKKEEKLKLKAEKEARKEEKRLAKEEERLAKLHAKEEKKRGKKEAKELLL
ANDGNSKKASFLDH

BO26711.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG8910-PA 608 CG8910-PA 1..608 1..608 3163 100 Plus
spen-PH 5458 CG18497-PH 1490..1912 208..597 172 22.5 Plus
spen-PC 5476 CG18497-PC 1508..1930 208..597 172 22.5 Plus
spen-PG 5487 CG18497-PG 1492..1914 208..597 172 22.5 Plus
spen-PE 5505 CG18497-PE 1510..1932 208..597 172 22.5 Plus