Clone BO26712 Report

Search the DGRC for BO26712

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG9795-RD
Protein status:BO26712.pep: Imported from assembly
Sequenced Size:2131

Clone Sequence Records

BO26712.complete Sequence

2131 bp assembled on 2010-09-13

GenBank Submission: KX796713

> BO26712.complete
GAAGTTATCAGTCGACATGAGCGTTTTGCGGGAGGAAACGACAACTTCCA
GCCAGAGGGAGATAAGCACAAACGGCGGTGGGTTGGATTTCCCCGCAGAA
GTGACGTCGCTGATTGCTGGCAACAGCTTTTGCTTAACGCCAGGAAATAA
CGGCGGGATCGGTGCCCAGAAAAAGGTCACTACTGGAGCGGGTCTGAACA
GTACACAGAGAGCTACGGATGCCACCAAGCGCAAGAAACTAAGGTCGCGT
AACGTACCACCTTCCCCATTGGCCCAAAAAACTGAAGCAGCGGCGACCTC
TCTTAACCAAACGAACATCGGTGAGGTCAAGAGAACCGATATTAACTATT
CCAACGATCACCTTGATGCCTGGTTGGAGAGCTGTTTACGTGATGCCACC
AACGCCCAATTGTCTTCTTCATCTGAGTTTTTGGACTTCATACCGCCCAC
AGCACCAGCTCATAAGCAAATGTTTTTGACTCAACAGCAGCAGCTGCCGC
AGCTTAAACAGCAACTACAGCAGCAGAGGCAACAGGAATTTTCGAAGCGA
ACCCAGCCTTACGGAGTGGGTCCAGGCACACCGTTTAGCCTGGGGATACA
GCGCAATTCGAACTCTCTTAGCCATCGATATCCGATGCTCTTCCCACCCC
AGAGCCTTAACAGCTATGGTGATGGTGGCCAGGAGTTTGCAAGCTTGCCT
CCCCTGAACAACATGATGGGAGGGCCGGAAGGGCTTGGGTGCGATCAGGA
ACCGAATTCGACGGATGTGCTGGATGGCAGCGAAAGCAATCCCAACTTTA
CCAAGGGATTTCGGTTCAGCGATCCGTGCCTACTGAACCCCTCCGATAAT
GACTCTAAGCTGAGTGGCCAGAATACACCAGAGTGTCGAAATGTGAACAA
CAATGGCAGTGGCTGTGATCTGGCACATCAAAACAAATTTTTCGCGGCTC
TAATGGAACAAATAAACATATTGCACGACACCAATTCCAAGATCTGCCGG
AATTTGCATAATACAAAAGTTGATATCGAAGCTTTAAAGCACTCCCCTAA
TAGCCAGCACTGGGCAGGTGTAGGCTTTGGGGGCATGCGGCACCGTAGAG
ATAGCTTAAGCGGGCTAAGCACACAAAGTCAACCTCTTATTCTTGGCAGT
GGATTGGGAGGGACACACAGCCCAGCGCCCACATTTCACTCAGGCGCCTA
CACTCCAGGAATGATGACGGATGTCGTGCGGGAAGTGAAGGAGGCAGCGC
GCATACGCGAAGATGCACTGCTAAGTCGAGTAAAATTAATGGTTGAAGAA
CGTCAGTGTTCCTTAAACGAGGGAAATGTCCGAATTCTGAGAGATATAGA
CGATCTAAAGACCCAAGTAATGCAGTTGCGACTGGAGAAAAAGGAGACTA
ACAAACGCCTCTCACATCTGGAATCCGAAAACAAGTGCCTTCGTCAAGCT
CTGGCCGGTTGTTATAACCAGCGGCCAATCAGTAACGACATTATTTACGA
AAATGACCGATCCCATGGATTCCGAAAGCCATTTCCGAATGGGGGTGGCG
GCGGAGTTGTGGGTTCCGGTGCCCTCGGAATACGACGGGCAAAATCTTTA
AACCTTCATTATGGAACAATGCATCAAACGCCTATCCAAACGACACACTC
TTTGGAAGAGGACGACGAAATAGAAGAGGAGCAGTTAGTAGAGCAAGTAG
GACTGGACGGAGAAGAATTATCCCTGACTGGCAACAACAGTTTATCGTGT
TTGAACATCGGTCATCAATCTCCCTCCAACTTAACGCCTCACTCACAGAT
ACCTAAATCAGAAAAGCAAGCAGTTAGAAGCCCTCCCTCTTTTGCGCTGG
CTTCTGACCAGATCAATCCGGGAATTCCACCGCCATTGCTACCACGAAAG
AAGGACCACGCTCATCTAAAGCGGGAGCGCAGCGAGGCGGCCTCCGTACG
TAAGGAGACAAATCAACGTATAATTGCCCTTGAGAAATTGGTTGAAGACC
TAAGTGACCAGGTGAGAGGTAAGACAAAGAGGAACCCGACCGTATCAAGC
ACTGCAGCGGACATAACGCTATCATCGAAATTCAGCGTGGCGGACGCTCC
GATTACGGACTTAGCAAGCTTTCTAGACCAT

BO26712.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG9795-RE 2211 CG9795-PE 110..2208 15..2113 10495 100 Plus
CG9795-RD 2100 CG9795-PD 1..2097 17..2113 10485 100 Plus
CG9795-RF 2082 CG9795-PF 110..2072 15..1977 9815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9795-RE 2573 CG9795-RE 214..2312 15..2113 10495 100 Plus
CG9795-RD 2825 CG9795-RD 180..2278 15..2113 10495 100 Plus
CG9795-RF 2390 CG9795-RF 214..2176 15..1977 9815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4324871..4325489 1359..1977 3095 100 Plus
3R 32079331 3R 4323229..4323622 211..604 1970 100 Plus
3R 32079331 3R 4323952..4324164 807..1019 1065 100 Plus
3R 32079331 3R 4323687..4323889 605..807 1015 100 Plus
3R 32079331 3R 4321850..4322047 15..212 990 100 Plus
3R 32079331 3R 4324335..4324511 1018..1194 885 100 Plus
3R 32079331 3R 4325697..4325832 1978..2113 680 100 Plus
3R 32079331 3R 4324584..4324672 1190..1278 445 100 Plus
3R 32079331 3R 4324729..4324811 1278..1360 415 100 Plus
Blast to na_te.dros performed 2014-11-28 08:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6761..6849 450..537 181 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6869..6922 482..535 171 79.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6740..6848 450..557 155 61.5 Plus
roo 9092 roo DM_ROO 9092bp 1124..1184 482..543 155 76.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2362 482..537 154 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2343..2399 482..538 150 73.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6806..6911 447..548 150 64.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6773..6858 447..534 147 64.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2364..2420 482..538 141 71.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6731..6787 482..538 141 71.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6752..6808 482..538 141 71.9 Plus
roo 9092 roo DM_ROO 9092bp 1079..1135 482..538 141 71.9 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3291..3364 482..555 136 64.9 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 639..715 559..483 133 63.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2820..2870 482..535 128 74.1 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 672..726 535..481 122 69.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2322..2374 482..534 121 69.8 Plus
roo 9092 roo DM_ROO 9092bp 1079..1162 447..535 118 62.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2763..2856 441..533 116 59.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2790..2832 482..524 116 74.4 Plus

BO26712.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:11 Download gff for BO26712.complete
Subject Subject Range Query Range Percent Splice Strand
CG9795-RD 175..2271 17..2115 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:26 Download gff for BO26712.complete
Subject Subject Range Query Range Percent Splice Strand
CG9795-RD 182..2278 17..2115 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:48 Download gff for BO26712.complete
Subject Subject Range Query Range Percent Splice Strand
CG9795-RD 182..2278 17..2115 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:48 Download gff for BO26712.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4325697..4325832 1978..2115 98   Plus
3R 4324873..4325489 1361..1977 100 -> Plus
3R 4324730..4324811 1279..1360 100 -> Plus
3R 4324588..4324672 1194..1278 100 -> Plus
3R 4324337..4324510 1020..1193 100 -> Plus
3R 4323953..4324164 808..1019 100 -> Plus
3R 4323687..4323889 605..807 100 -> Plus
3R 4323231..4323622 213..604 100 -> Plus
3R 4321852..4322047 17..212 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:26 Download gff for BO26712.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 151419..151554 1978..2115 98   Plus
arm_3R 150595..151211 1361..1977 100 -> Plus
arm_3R 150452..150533 1279..1360 100 -> Plus
arm_3R 150310..150394 1194..1278 100 -> Plus
arm_3R 150059..150232 1020..1193 100 -> Plus
arm_3R 149675..149886 808..1019 100 -> Plus
arm_3R 149409..149611 605..807 100 -> Plus
arm_3R 148953..149344 213..604 100 -> Plus
arm_3R 147574..147769 17..212 100 -> Plus

BO26712.pep Sequence

Translation from 16 to 2131

> BO26712.pep
MSVLREETTTSSQREISTNGGGLDFPAEVTSLIAGNSFCLTPGNNGGIGA
QKKVTTGAGLNSTQRATDATKRKKLRSRNVPPSPLAQKTEAAATSLNQTN
IGEVKRTDINYSNDHLDAWLESCLRDATNAQLSSSSEFLDFIPPTAPAHK
QMFLTQQQQLPQLKQQLQQQRQQEFSKRTQPYGVGPGTPFSLGIQRNSNS
LSHRYPMLFPPQSLNSYGDGGQEFASLPPLNNMMGGPEGLGCDQEPNSTD
VLDGSESNPNFTKGFRFSDPCLLNPSDNDSKLSGQNTPECRNVNNNGSGC
DLAHQNKFFAALMEQINILHDTNSKICRNLHNTKVDIEALKHSPNSQHWA
GVGFGGMRHRRDSLSGLSTQSQPLILGSGLGGTHSPAPTFHSGAYTPGMM
TDVVREVKEAARIREDALLSRVKLMVEERQCSLNEGNVRILRDIDDLKTQ
VMQLRLEKKETNKRLSHLESENKCLRQALAGCYNQRPISNDIIYENDRSH
GFRKPFPNGGGGGVVGSGALGIRRAKSLNLHYGTMHQTPIQTTHSLEEDD
EIEEEQLVEQVGLDGEELSLTGNNSLSCLNIGHQSPSNLTPHSQIPKSEK
QAVRSPPSFALASDQINPGIPPPLLPRKKDHAHLKRERSEAASVRKETNQ
RIIALEKLVEDLSDQVRGKTKRNPTVSSTAADITLSSKFSVADAPITDLA
SFLDH

BO26712.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9795-PE 736 CG9795-PE 38..736 1..699 3638 100 Plus
CG9795-PD 699 CG9795-PD 1..699 1..699 3638 100 Plus
CG9795-PF 693 CG9795-PF 38..691 1..654 3422 100 Plus
CG9795-PA 501 CG9795-PA 1..493 152..644 2603 100 Plus