Clone BO26713 Report

Search the DGRC for BO26713

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG32091-RB
Protein status:BO26713.pep: Imported from assembly
Sequenced Size:1903

Clone Sequence Records

BO26713.complete Sequence

1903 bp assembled on 2010-09-13

GenBank Submission: KX799146

> BO26713.complete
GAAGTTATCAGTCGACATGGAACAGTCGCAGAACTTACTCGCCAAACAGT
CCAAAAATGTGGAGTTCCAAGATGTGTACTACACCGTCAAGGAGCGCAAG
AATTTCTGGCGCGTAACCGGTGAGCGTCGAATTCTGAATGGAGTCAGCGG
CAGTTTCCGGAATGGTCAACTTTCGGCAATCATGGGACCCTCAGGAGCCG
GAAAAAGCAGTTTGCTTAATGCGATTTCGGGTTTCAGACGCGACGGAGTC
ACTGGGAACATCAAGATGAAGCGGGACAATGCCTGCTATATCACTCAGGA
CGACCACCACCAGACCCTGCTGACTGTCGAGGAGCTTATGAATCTCGCCT
GCGATCTCAAGTTAAAGAATCGTCACAAAAAGGCTGAAATCATGACCGAT
ATATTGGAGAATCTGCACTTGAATCACCGGCGCAATGTGACGGCAGAGAA
GTTGAGTGGCGGGGAGCGTAAGCGATTGTCCATCGCCCTGGAGCTGGTGG
ACAATCCAAACATATTCTTCTTGGACGAACCAACCAGTGGCCTGGACGAA
GTGACAGCGGCCCAGTGCATCCGTTTGCTGCAGGCGATGGCATACGAGGG
TCGCACCATCGTTTGCACCATCCATCAACCTTCGGCCACGATATACAACT
ACTTCGATAGCATCTACGTCCTGGCCAAGGGCCAATGTGTCTACCAAGGC
AGTCCCAGAGCCACCATTCCCTTTCTGCGATTGGCCCAGCTGGATTGCCC
CAGGCATTACAGTCCTTCGGATTATATTATTGAGCTGGTGGATGCCGAGG
ATGGACACCTGGTGCCAGCACTCAGCGACCTAACCGAAAACGGGAAGCTG
ATCTATGTGGTCAGTCAGTCTGAGCAATTGGCACCTCAGCAGGCGGTCAC
CACAATGTTTCTGGAGCAACAGAAGCGTCCATTCTTGCCCGCCTTTTTCG
CTGGCAGCGCCGCCTCCACGGATGGAACGCTAATTGGAGGCACCAGTGCT
CTGTTGGAGCAAGTGAAGGCCTTCTCGAAGAGACTCCATACGGATCGGCG
GGATGTATGTGGGTTTCGTCAGTTTATCGTTCTTATGCGAATAATGCTAC
TGAGAATAACGCGTGCTCGTTTGGCACTGACCATCCAATTGTTCCATCAC
CTGCTGTGCGGTCTGTTCTTTGGCCTGATATTCTTCCAACTGGGCAACCA
AGGTGCCCGGATGTTCGATCATCTGAAATTCTGCATCGGCGCCGTCCTCA
TGATCGTGTACACCCAGGTGATGGTGCCCATTTTGAGCTATCCCGCTGAG
GTGAAACTGGTCAAGAAGGAGACCTTTAATCGTTGGTATACCCTCACCCC
GTACTACATGGCCCTCACAGTTTCGCGACTGCCAGTTCAAGTGCTACTCA
ACATCACCTTCATGGCTGTCACGTACTGGATGTCCGGATTGCCGCAGCAG
TTCTGGCGCTTCTGCATTTTTGTGGCTGTGGGTTTGATGATCTCATTGGT
GGCCGAGGGAATGGGCCTGGCAATTGGAGCCACCTTCAGCATTACGAATG
GCAGTGTGGTGGGTCCGATGCTAATAGCTCCTCTGATGGGTTTGGCCGTC
TACGGATTTGACTTTGCGCCGCAGGTATCCGGCGGAATGCAACTGCTGAT
GAAATTCAGCTATGTGCGTGTGGGCGTGGTTTCGTTGGTTTTAGCCGTCT
TCGGATTTCAGCGGGAAGAACTCGACTGCGATGCGATATACTGTCATTTT
AGCGATCCTCGCGTGCTGCTCAAATTTTTGGATGTGGAAAAGGTGTCGAT
GCTCCATCAGTTCGGATTGCTGGCCATGCTGATGCTGTTCTTCCGAGTGA
TGATGTACATCAGCCTGCGAAAGCGATGCTATGCCGCAAGCTTTCTAGAC
CAT

BO26713.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG32091-RB 1872 CG32091-PB 1..1869 17..1885 9345 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG32091-RB 2967 CG32091-RB 680..2555 10..1885 9365 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11640651..11641195 232..776 2725 100 Plus
3L 28110227 3L 11641261..11641773 777..1289 2565 100 Plus
3L 28110227 3L 11642151..11642490 1546..1885 1700 100 Plus
3L 28110227 3L 11641833..11642089 1290..1546 1285 100 Plus
3L 28110227 3L 11640068..11640197 108..237 650 100 Plus
3L 28110227 3L 11635094..11635192 10..108 480 99 Plus
Blast to na_te.dros performed on 2014-11-28 08:59:24 has no hits.

BO26713.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:07 Download gff for BO26713.complete
Subject Subject Range Query Range Percent Splice Strand
CG32091-RB 684..2552 17..1887 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:18 Download gff for BO26713.complete
Subject Subject Range Query Range Percent Splice Strand
CG32091-RB 687..2555 17..1887 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:40 Download gff for BO26713.complete
Subject Subject Range Query Range Percent Splice Strand
CG32091-RB 687..2555 17..1887 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:40 Download gff for BO26713.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11642152..11642490 1547..1887 99   Plus
3L 11641833..11642089 1290..1546 100 -> Plus
3L 11641261..11641773 777..1289 100 -> Plus
3L 11640657..11641195 238..776 100 -> Plus
3L 11640068..11640197 108..237 100 -> Plus
3L 11635101..11635191 17..107 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:18 Download gff for BO26713.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11635252..11635590 1547..1887 99   Plus
arm_3L 11634933..11635189 1290..1546 100 -> Plus
arm_3L 11634361..11634873 777..1289 100 -> Plus
arm_3L 11633757..11634295 238..776 100 -> Plus
arm_3L 11633168..11633297 108..237 100 -> Plus
arm_3L 11628201..11628291 17..107 100 -> Plus

BO26713.pep Sequence

Translation from 16 to 1903

> BO26713.pep
MEQSQNLLAKQSKNVEFQDVYYTVKERKNFWRVTGERRILNGVSGSFRNG
QLSAIMGPSGAGKSSLLNAISGFRRDGVTGNIKMKRDNACYITQDDHHQT
LLTVEELMNLACDLKLKNRHKKAEIMTDILENLHLNHRRNVTAEKLSGGE
RKRLSIALELVDNPNIFFLDEPTSGLDEVTAAQCIRLLQAMAYEGRTIVC
TIHQPSATIYNYFDSIYVLAKGQCVYQGSPRATIPFLRLAQLDCPRHYSP
SDYIIELVDAEDGHLVPALSDLTENGKLIYVVSQSEQLAPQQAVTTMFLE
QQKRPFLPAFFAGSAASTDGTLIGGTSALLEQVKAFSKRLHTDRRDVCGF
RQFIVLMRIMLLRITRARLALTIQLFHHLLCGLFFGLIFFQLGNQGARMF
DHLKFCIGAVLMIVYTQVMVPILSYPAEVKLVKKETFNRWYTLTPYYMAL
TVSRLPVQVLLNITFMAVTYWMSGLPQQFWRFCIFVAVGLMISLVAEGMG
LAIGATFSITNGSVVGPMLIAPLMGLAVYGFDFAPQVSGGMQLLMKFSYV
RVGVVSLVLAVFGFQREELDCDAIYCHFSDPRVLLKFLDVEKVSMLHQFG
LLAMLMLFFRVMMYISLRKRCYAASFLDH

BO26713.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG32091-PB 623 CG32091-PB 1..623 1..623 3201 100 Plus
CG3164-PD 698 CG3164-PD 36..691 5..618 1022 34.9 Plus
CG3164-PB 698 CG3164-PB 36..691 5..618 1022 34.9 Plus
CG3164-PC 699 CG3164-PC 37..692 5..618 1022 34.9 Plus
CG3164-PA 699 CG3164-PA 37..692 5..618 1022 34.9 Plus