Clone BO26715 Report

Search the DGRC for BO26715

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptCG5001-RA
Protein status:BO26715.pep: Imported from assembly
Sequenced Size:1084

Clone Sequence Records

BO26715.complete Sequence

1084 bp assembled on 2010-08-18

GenBank Submission: KX796258

> BO26715.complete
GAAGTTATCAGTCGACATGGGTAAGGACTACTACAAAATCCTGGGTCTGC
CCAAAACTGCCACCGACGATGAGATCAAAAAGGCCTACAGGAAACTGGCC
CTGCGTTATCATCCGGACAAAAACAAAGCCGCCAACGCCGAGGACAAGTT
CAAGGAGGTCGCCGAGGCGTACGAGGTTCTTTCGGACAAGAGCAAGCGGG
AGGTGTACGACAAATACGGCGAGGATGGTCTCAAGAGCGGAGGCACACGA
AACGGCGGTCCGTCGAGCAACTCGTTTACATATCAGTTCCACGGCGATCC
GCGGGCCACCTTCGCCCAGTTCTTTGGCAACAGCAATCCGTTCGCCTCGT
TCTTCGACATGGGCGACAACCTGTTCGACAAGAAGGTCTTCGATCTGGAC
ACGGAACCCGATTTCTTCTCCTCGCCCTTTGGCGGCATTGGGTCGCGACA
TGGTCTGGGAAGTGGCTTCAGGCCCTCTTTCAGATCACACTCCTTCAATG
TGCACACGCCGTTCAAGAAGGAGCAGAAGCAGGATCCGCCCGTCGAACAC
GATCTCTATGTGACGCTGGAGGAGATCTACCACGGCTGTGTTAAGAAAAT
GAAAATCTCCCGGCGCATCGTTCAGGCGGACGGCAGTTCCCGCAAGGAGG
AGAAGTTCCTGGCGATATCCATCAAGCCCGGCTGGAAGTCCGGCACCAAG
GTCACCTTCCAGAAGGAGGGCGACCAGGCGCCCGGAAAAATTCCCGCCGA
CATTGTGTTCATCATCCGGGACAAGCCGCACGCCATGTTCAAGCGCGAGG
GCAGCGATCTGCGCTACACGGCGAGACTGACGCTCAAGCAGGCTTTGTGC
GGCGTTGTCTTCCAAGTTCCTACCATGTCCGGCGACAAGTTGCGCATCAG
CACCATGCAGGAGATCATCAAGCCGAACACGGTGAAGCGCATCCAGGGAT
ACGGGCTGCCATTCCCCAAGGATACGACGCGCAAGGGCGACCTCCTGGTG
GCCTTCGACATTCAGTTCCCGGAGAAGCTGACCGCCGCCCAGAAGGAGGT
GCTCAAGGACATGTTAGCAAGCTTTCTAGACCAT

BO26715.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5001-RD 1053 CG5001-PD 1..1050 17..1066 5250 100 Plus
CG5001-RA 1053 CG5001-PA 1..1050 17..1066 5250 100 Plus
CG5001-RB 1053 CG5001-PB 1..1050 17..1066 5250 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:55:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG5001-RD 1755 CG5001-RD 339..1388 17..1066 5250 100 Plus
CG5001-RA 1833 CG5001-RA 417..1466 17..1066 5250 100 Plus
CG5001-RB 1893 CG5001-RB 477..1526 17..1066 5250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1192253..1192626 469..842 1870 100 Plus
2L 23513712 2L 1191968..1192199 241..472 1160 100 Plus
2L 23513712 2L 1196213..1196440 839..1066 1140 100 Plus
2L 23513712 2L 1191684..1191910 17..243 1135 100 Plus
3L 28110227 3L 5751369..5751551 241..59 300 77.6 Minus
3L 28110227 3L 5750854..5751021 810..643 195 74.4 Minus
Blast to na_te.dros performed on 2014-11-27 00:55:21 has no hits.

BO26715.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:52:51 Download gff for BO26715.complete
Subject Subject Range Query Range Percent Splice Strand
CG5001-RA 415..1464 17..1068 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:38:39 Download gff for BO26715.complete
Subject Subject Range Query Range Percent Splice Strand
CG5001-RB 477..1526 17..1068 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:13:39 Download gff for BO26715.complete
Subject Subject Range Query Range Percent Splice Strand
CG5001-RB 477..1526 17..1068 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:13:39 Download gff for BO26715.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1196216..1196440 842..1068 99   Plus
2L 1192256..1192625 472..841 100 -> Plus
2L 1191970..1192198 243..471 100 -> Plus
2L 1191684..1191909 17..242 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:38:39 Download gff for BO26715.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1196216..1196440 842..1068 99   Plus
arm_2L 1192256..1192625 472..841 100 -> Plus
arm_2L 1191970..1192198 243..471 100 -> Plus
arm_2L 1191684..1191909 17..242 100 -> Plus

BO26715.pep Sequence

Translation from 16 to 1084

> BO26715.pep
MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAE
AYEVLSDKSKREVYDKYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFA
QFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSG
FRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRR
IVQADGSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFII
RDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEI
IKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML
ASFLDH

BO26715.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5001-PD 350 CG5001-PD 1..350 1..350 1842 100 Plus
CG5001-PA 350 CG5001-PA 1..350 1..350 1842 100 Plus
CG5001-PB 350 CG5001-PB 1..350 1..350 1842 100 Plus
CG5001-PC 346 CG5001-PC 1..346 1..350 1805 98.9 Plus
DnaJ-1-PA 334 CG10578-PA 1..332 1..350 1034 57 Plus