Clone BO26716 Report

Search the DGRC for BO26716

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptCG9657-RA
Protein status:BO26716.pep: Imported from assembly
Sequenced Size:1837

Clone Sequence Records

BO26716.complete Sequence

1837 bp assembled on 2010-10-15

GenBank Submission: KX793901

> BO26716.complete
GAAGTTATCAGTCGACATGCACGTGGAGGAGCTGAGAGCCAGCCTGCAGA
GCTTTGGATGGCCGGATTATTTGGTCTTTTGCCTGATGTTGGCCATTTGC
GCCGTTATCGGTATATATTTTTGCCTGCAACTGCGCTTAGAGTCCAGGAA
ACAAAAGGCCAATGGCTCAGAGGAGGCGGCGAGTAGTGCTGCCTCGTATT
TGGTTGGTGGCAGGCAGATGAAGATCTTTCCCATAACCATGTCACTGATA
TCCAGCTTTATATCTGGAATTACACTTTTGGGTACTCCCACAGAGGTTTA
TCTTTATGGTGCTCAGTACATGTACATTATGGGATCGCTGGTTTTAATGG
GCTTCTGCATGTACTACTTCTTCTTGCCGGTCTTTCACGAACTCAATTTG
ATATCCACTTATAAGTATTTGGAACAGCGATATAACCGAAGTTTAAGGCT
TTTCGGATCTGTCATGTTTATTGTGGCTTCGCTACTTTGGCTTCCAATTG
TGATTTATGTACCGGCTATAGCATTCAATCAGGCCACTGGAGTGAACATC
CATATAGTGACGCCCATTGTGTGTGTGGTTTGCATTTTCTATACTTGCAT
TGGAGGTTTGAAGGCGGTGGTTTGGACGGATGTCATCCAAACGTTGATCA
TGTTCGGTGCGATGGCTTTGGTTTTGATTAAGGGAACCCTGGATATCGGC
GGACCTGGAGTTGTGTGGCAGAAGGCCCAAGAAACAGCTCGATTGGAAGT
ACCCAATTTTAGTGCGGATCTAAGTGAGCGGTATACCTTTTATTCCCTGG
TTTTGGGCGGTGTAGCTCATTGGCTCAAGTCAAATGCAATTAGTCAGAAT
ATGATCCAGAGATATTTATCGCTACCCACGCTTCGTGATGCACGGATTGC
AATATGGACATTTATCGCTGGTGTTTTGGCCTTTTTGATGATCTGCGGAT
ATACGGGTCTTTTGATCTATGCCACCTATTCTCAATGTGATCCTTTGGAA
ACGAAGTTGGCCCAGAGAAACGATCAACTTTTGCCACTTTTGGTAATGGA
CACTTTGGGCTCATATCCGGGTTTACCAGGAGTATTTGTAGCCGGTGTTT
TTAGTGCGGCATTGTCTTCGTTATCGACAGGGTTGAACTCTCTATCTGCA
GTCGTTTTGGAAGATTTTGTAAAGACCTTTAGAAAGAGTCCACTGACCGA
GGGACAAACCGCTTTTGTGATGCGCAGTGTGGTCGTTGTATTTGGCATTA
TATTCGTAGCTCTCGTATTTGCCGTGGAAAAATTAGGTGCCGTTCTGCAA
CTGACCATCACACTTTCGTCGGTGGCAAATGGACCACTCTTGGGTATATT
TACCGCCGGAGTTATGTTGCCATGGGTTAATTCTAAAGGAGCTTTGCTCG
GAGGATTCAGTTCACTTATTGTTATGGCCTGGATGTGTGTAAGTGCCCAG
CGGGATCTGGTCACCGGTGATCTCGTCTATAAGAGGAAACCATATTCAAC
GATGGGCTGCAATTATACGTTTGCCGGAGAACCACGCGAGTTTGCCAGCC
TGGCATTAGATGGTGCCATCAGTTCCGTTCCAAGTGCTCCCTTCCAGCTG
TATCGCATATCGTATCTCTATTTCACGCTTTTTGGAGCCCTGGTGACGAT
TGTAGTGGCACTGGTCACAAGTCTCCTCCTCCGGGAGACGGATTTGGATG
GAGTTGACACACGTCTGCTCACACCATTTGTGAGACGCTGGTTAGAGCGA
CGTCGCCATCGCCGATCAAAGATACCAGATTCTGGTCAAAAATCCAGCAA
CAAACAGGAGACGAAAACGGCAAGCTTTCTAGACCAT

BO26716.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG9657-RB 1806 CG9657-PB 1..1803 17..1819 9015 100 Plus
CG9657-RA 1806 CG9657-PA 1..1803 17..1819 9015 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG9657-RB 2557 CG9657-RB 132..1934 17..1819 9015 100 Plus
CG9657-RA 2054 CG9657-RA 132..1934 17..1819 9015 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7420119..7421210 481..1572 5460 100 Plus
X 23542271 X 7421270..7421519 1570..1819 1250 100 Plus
X 23542271 X 7418725..7418963 17..255 1195 100 Plus
X 23542271 X 7419771..7419933 253..415 815 100 Plus
X 23542271 X 7419990..7420057 414..481 340 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:03:19 has no hits.

BO26716.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:04 Download gff for BO26716.complete
Subject Subject Range Query Range Percent Splice Strand
CG9657-RA 132..1934 17..1821 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:29 Download gff for BO26716.complete
Subject Subject Range Query Range Percent Splice Strand
CG9657-RA 132..1934 17..1821 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:30 Download gff for BO26716.complete
Subject Subject Range Query Range Percent Splice Strand
CG9657-RA 132..1934 17..1821 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:30 Download gff for BO26716.complete
Subject Subject Range Query Range Percent Splice Strand
X 7421273..7421519 1573..1821 99   Plus
X 7420120..7421210 482..1572 100 -> Plus
X 7419992..7420057 416..481 100 -> Plus
X 7419774..7419933 256..415 100 -> Plus
X 7418725..7418963 17..255 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:29 Download gff for BO26716.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7315306..7315552 1573..1821 99   Plus
arm_X 7314153..7315243 482..1572 100 -> Plus
arm_X 7314025..7314090 416..481 100 -> Plus
arm_X 7313807..7313966 256..415 100 -> Plus
arm_X 7312758..7312996 17..255 100 -> Plus

BO26716.pep Sequence

Translation from 16 to 1837

> BO26716.pep
MHVEELRASLQSFGWPDYLVFCLMLAICAVIGIYFCLQLRLESRKQKANG
SEEAASSAASYLVGGRQMKIFPITMSLISSFISGITLLGTPTEVYLYGAQ
YMYIMGSLVLMGFCMYYFFLPVFHELNLISTYKYLEQRYNRSLRLFGSVM
FIVASLLWLPIVIYVPAIAFNQATGVNIHIVTPIVCVVCIFYTCIGGLKA
VVWTDVIQTLIMFGAMALVLIKGTLDIGGPGVVWQKAQETARLEVPNFSA
DLSERYTFYSLVLGGVAHWLKSNAISQNMIQRYLSLPTLRDARIAIWTFI
AGVLAFLMICGYTGLLIYATYSQCDPLETKLAQRNDQLLPLLVMDTLGSY
PGLPGVFVAGVFSAALSSLSTGLNSLSAVVLEDFVKTFRKSPLTEGQTAF
VMRSVVVVFGIIFVALVFAVEKLGAVLQLTITLSSVANGPLLGIFTAGVM
LPWVNSKGALLGGFSSLIVMAWMCVSAQRDLVTGDLVYKRKPYSTMGCNY
TFAGEPREFASLALDGAISSVPSAPFQLYRISYLYFTLFGALVTIVVALV
TSLLLRETDLDGVDTRLLTPFVRRWLERRRHRRSKIPDSGQKSSNKQETK
TASFLDH

BO26716.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG9657-PB 601 CG9657-PB 1..601 1..601 3054 100 Plus
CG9657-PA 601 CG9657-PA 1..601 1..601 3054 100 Plus
CG6723-PA 587 CG6723-PA 3..558 2..575 1568 52.4 Plus
CG42235-PB 695 CG42235-PB 90..692 1..595 1473 48.1 Plus
CG42235-PA 695 CG42235-PA 90..694 1..597 1453 47.9 Plus