Clone BO26717 Report

Search the DGRC for BO26717

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:17
Vector:pDNR-Dual
Associated Gene/TranscriptCG10628-RA
Protein status:BO26717.pep: Imported from assembly
Sequenced Size:1183

Clone Sequence Records

BO26717.complete Sequence

1183 bp assembled on 2010-08-18

GenBank Submission: KX800113

> BO26717.complete
GAAGTTATCAGTCGACATGGTGCAAATCTTTAAATTCCTGTTAAAATCCA
GCAAATCTACCGGTCGTGCCCACTTCCGGCCCACTTTTCTGGACACACTG
CGCCTAGCGGTTCGTGGAGGACATGGTGGAAATGGACTGCCCAAATACGG
AGGAGTTGGTGGCCAAGGCGGTTGCGTCTACTTGGTGGCAAAGGAAGGAC
TCACCCTTCGCAAGGTCGTCCAGGGATTGAAGGATAAGCGAGTGGCAGCA
TCCAGTGGCGAGGACAGTAGCAAAGCCAGCATCTTTGGACGCCGTGGAGC
TGACCAGAGGATCGAGGTGCCTGTGGGCGTCCAGGTATATGACGACCAAC
AAAAACTCATCGCCGACCTCGACGAGCACGAGGCGACATGCATTGTGGCG
GGCGGAGGTACTGGCGGATGCACGGCCACAAATTTTCTGGGACGTCCCGG
GGAGAATCGCACTGTAAATCTGGACCTAAAGCTAATAGCAGATGTGGGTC
TCGTGGGATTCCCCAACGCTGGCAAAAGCACCCTTCTTAAGGCCGTGTCC
AATGCCAAACCAAAAATTGCAGCTTATCCCTTTACCACCATCCGACCCCA
GATTGGAACCATCGAGTACAGGGACCTGCGCTCCATCACAGTTGCCGATC
TTCCCGGTCTGATCGAGGGCGCCCACGCGAACTTCGGCATGGGTCACAAG
TTCCTGAAGCACATCGAACGCACCCGCCTGCTGGTCTTCATGGTGGATAT
ATTCGGCTTCCAGCTGAGTCCCAAACATCCGCATCGCGACTGCTTGGCCA
ATGTGTATGCGCTCAACAAAGAGTTGGAGCTCTACGATCCATCGCTGCTG
GAGAAGCCCAGTGTCCTGCTGCTGAACAAAATGGACAAGGAGGGTGCCCA
CGAGATCTTTACCAAAGTTAAGCCGCTCGTCAGCGATTTGGCCAGCGGAC
TTGAACAGTGCCCCGAGGAACTGCGTCCGAAACAGGTGCTCAATTTCGAC
AGCATTGTCCCCATATCGGCCATGAACTCGTCGAAGATCACGCAAGTGAA
ATCCCAGCTAAGGAGGACCCTGGTGCGGCTGGCTGAGAAGCAGTTCCTGG
CGGACGAGGATCAGGTCAAGGAGAAGCTAAGACAGCGCGTTGGGGTGGTG
GGTCCAAAAATTACCGCAAGCTTTCTAGACCAT

BO26717.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG10628-RA 1152 CG10628-PA 1..1149 17..1165 5745 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG10628-RA 1254 CG10628-RA 43..1191 17..1165 5745 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19757308..19757891 1165..582 2920 100 Minus
2L 23513712 2L 19757950..19758472 581..59 2615 100 Minus
2L 23513712 2L 19758532..19758573 58..17 210 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:55:40 has no hits.

BO26717.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:52:52 Download gff for BO26717.complete
Subject Subject Range Query Range Percent Splice Strand
CG10628-RA 41..1189 17..1167 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:38:51 Download gff for BO26717.complete
Subject Subject Range Query Range Percent Splice Strand
CG10628-RA 43..1191 17..1167 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:13:47 Download gff for BO26717.complete
Subject Subject Range Query Range Percent Splice Strand
CG10628-RA 43..1191 17..1167 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:13:47 Download gff for BO26717.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19758532..19758573 17..58 100   Minus
2L 19757950..19758472 59..581 100 <- Minus
2L 19757306..19757891 582..1167 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:38:51 Download gff for BO26717.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19758532..19758573 17..58 100   Minus
arm_2L 19757950..19758472 59..581 100 <- Minus
arm_2L 19757306..19757891 582..1167 99 <- Minus

BO26717.pep Sequence

Translation from 16 to 1183

> BO26717.pep
MVQIFKFLLKSSKSTGRAHFRPTFLDTLRLAVRGGHGGNGLPKYGGVGGQ
GGCVYLVAKEGLTLRKVVQGLKDKRVAASSGEDSSKASIFGRRGADQRIE
VPVGVQVYDDQQKLIADLDEHEATCIVAGGGTGGCTATNFLGRPGENRTV
NLDLKLIADVGLVGFPNAGKSTLLKAVSNAKPKIAAYPFTTIRPQIGTIE
YRDLRSITVADLPGLIEGAHANFGMGHKFLKHIERTRLLVFMVDIFGFQL
SPKHPHRDCLANVYALNKELELYDPSLLEKPSVLLLNKMDKEGAHEIFTK
VKPLVSDLASGLEQCPEELRPKQVLNFDSIVPISAMNSSKITQVKSQLRR
TLVRLAEKQFLADEDQVKEKLRQRVGVVGPKITASFLDH

BO26717.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG10628-PA 383 CG10628-PA 1..383 1..383 1954 100 Plus
CG13390-PA 381 CG13390-PA 40..351 10..312 426 33.6 Plus
128up-PA 368 CG8340-PA 47..188 130..293 179 34.5 Plus