Clone BO26723 Report

Search the DGRC for BO26723

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:23
Vector:pDNR-Dual
Associated Gene/TranscriptRad17-RA
Protein status:BO26723.pep: Imported from assembly
Sequenced Size:1639

Clone Sequence Records

BO26723.complete Sequence

1639 bp assembled on 2010-09-13

GenBank Submission: KX798198

> BO26723.complete
GAAGTTATCAGTCGACATGAGCGTACGGAAGAAAACTTGGGTAAGATGTG
CCTTCAGCGAGATGAACTTGACCACCAGTCCTGCTCCTTCGGAATCCACG
CCTGCGAAGCGCACAAGAAGTGCAAGCAATGTGAGCAGCTCCAGAGTATC
GAGGTCGAGAACTCCAAGCATAAATACAAAGCCAATACAGATTCCGGACG
TGGACTCAGTCGATCTTACTGCCATGGATGATGACCAGGATGCGGACATC
ACTGTGCCACCGCCAGAAGTCAAAGAAAACTGGATGGAAAGCTTTGAGCC
AGCCACCAGCGACGATTTGGCGGTGCATCCAAAGAAGGTCGGAGAACTAC
GCGATTGGCTGCGTCACTGCGAAGCGGTGCGCAAGAAGTTCCCGGCTCAA
ATGTGTCTACTTACCGGGCCCACTGGTGCTGGCAAAACCACCACGTTGCG
AGTCCTGGCCAAGGAGTTCGGCTACCAGCTGCAGGAGTGGATCAATCCTA
TCGATTGTGAGGTGGTCAACACCTTGGGTGATCAAACGACTGGCGCCTCC
TATGTGGGCTCCCATCTGGAGGCCTTTAAAAGCTTTCTGCTCCGTGCCTC
GCGATACAAATCCTTGCTGGACTCGCAAAATAAGAGACTGCTTCTTGTCG
AGGACTTTCCCAACGTCCTGCTCAGCGATAAGGAGGTCAACTTTGAAGAG
TTACTAGAAGAGTACACGGCGTATGGCAAATCTCCCCTGGTGTTCATCGT
TGCCGATGCCAAATCTCGAGGATTGAATATCAGCTACCGCCTCTTTCCAG
ACCAACTGAAGGCCAAACATCGCATCGAGCACATCAGTTTCAATGCTATT
GCATCTACAATCATGCAAAAGTCAATGAAAACCTTCTGCTCCGTAATGCA
GCAGAATAAAGCTACTTACAAGGTGCCCTCGACCGCTGTTGTTGACTCAA
TAGTTGTCGGTGCCCAGGGCGACATAAGAAATGCGTTAATTAATTTACAT
TTGAGCTCTTTAAAGGGAGTTTCCAGCATGCCGACCAAACAGCTAAATGT
CAGTGTGTCCGCAAAAGGTCGTAAGAAGAAAATGCAAAGTACTTTAAAGT
CAATTGGTAGAGATGAATCAATTACTCTGATGCACGCACTTGGAAGAGTA
TTAAATCCTAAGTTTAATGAGGACAAAACTATGTTACACAGCCCGGAGGA
AATAACCGAAGCCTTTAATACAGAGCCCAGGAATTTTGTGAATTTTGTAT
ATGCCAACTATCTGCCGCATTTTAAGGAAATCGATGATGTCGTGACCGCC
ATAAATGACTTGGGCCTATCAGATTGCATGCTCAACGAGTACAGAGATGA
TAATTTGTCTGTGATGGGCTTAAACGTTGCCATACGAGGAGTTATGATGT
CCAATACGTGCCCTGTCAGCGGATGGATGCCTGTTCGAGGACCCAAGCGA
ATCAATATACAGCCACAGGCAACTTTGGCCGAACAAAGACTAGTGGGTGT
GGGCTACGCGGGCATTGCCAGGACGCTCTACGCCACGGAGTACAGCTCAT
TAGTTAAGTTAATAGCAGGCAAGCCTGTGGATACTACTTCAAGCCAAAGC
ACAGACTCAAAACAAGACTTTGCAAGCTTTCTAGACCAT

BO26723.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:59:37
Subject Length Description Subject Range Query Range Score Percent Strand
Rad17-RA 1608 CG7825-PA 1..1605 17..1621 8010 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
Rad17-RA 1823 CG7825-RA 49..1653 17..1621 8010 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14662403..14663081 708..30 3395 100 Minus
3R 32079331 3R 14661858..14662316 1167..709 2280 99.8 Minus
3R 32079331 3R 14661346..14661803 1621..1164 2275 99.8 Minus
Blast to na_te.dros performed on 2014-11-28 08:59:36 has no hits.

BO26723.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:09 Download gff for BO26723.complete
Subject Subject Range Query Range Percent Splice Strand
Rad17-RA 44..1648 17..1623 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:21 Download gff for BO26723.complete
Subject Subject Range Query Range Percent Splice Strand
Rad17-RA 44..1648 17..1623 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:44 Download gff for BO26723.complete
Subject Subject Range Query Range Percent Splice Strand
Rad17-RA 49..1653 17..1623 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:44 Download gff for BO26723.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14662403..14663079 32..708 100 <- Minus
3R 14661862..14662316 709..1163 100 <- Minus
3R 14661344..14661803 1164..1623 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:21 Download gff for BO26723.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10488125..10488801 32..708 100 <- Minus
arm_3R 10487584..10488038 709..1163 100 <- Minus
arm_3R 10487066..10487525 1164..1623 99 <- Minus

BO26723.pep Sequence

Translation from 16 to 1639

> BO26723.pep
MSVRKKTWVRCAFSEMNLTTSPAPSESTPAKRTRSASNVSSSRVSRSRTP
SINTKPIQIPDVDSVDLTAMDDDQDADITVPPPEVKENWMESFEPATSDD
LAVHPKKVGELRDWLRHCEAVRKKFPAQMCLLTGPTGAGKTTTLRVLAKE
FGYQLQEWINPIDCEVVNTLGDQTTGASYVGSHLEAFKSFLLRASRYKSL
LDSQNKRLLLVEDFPNVLLSDKEVNFEELLEEYTAYGKSPLVFIVADAKS
RGLNISYRLFPDQLKAKHRIEHISFNAIASTIMQKSMKTFCSVMQQNKAT
YKVPSTAVVDSIVVGAQGDIRNALINLHLSSLKGVSSMPTKQLNVSVSAK
GRKKKMQSTLKSIGRDESITLMHALGRVLNPKFNEDKTMLHSPEEITEAF
NTEPRNFVNFVYANYLPHFKEIDDVVTAINDLGLSDCMLNEYRDDNLSVM
GLNVAIRGVMMSNTCPVSGWMPVRGPKRINIQPQATLAEQRLVGVGYAGI
ARTLYATEYSSLVKLIAGKPVDTTSSQSTDSKQDFASFLDH

BO26723.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Rad17-PA 535 CG7825-PA 1..535 1..535 2738 100 Plus