Clone BO26725 Report

Search the DGRC for BO26725

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptCG8027-RA
Protein status:BO26725.pep: Imported from assembly
Sequenced Size:2032

Clone Sequence Records

BO26725.complete Sequence

2032 bp assembled on 2010-09-13

GenBank Submission: KX798538

> BO26725.complete
GAAGTTATCAGTCGACATGCGATTACGCCGCCGTTGGCCGCGAAGGATGC
GGCGTGCCATGGAACAACTGCGTCTCCAGTCCCGCCGGAAGCTGCTGGCG
CTCACGATGACTGGAGGACTCTGCCTGGCTATCTGGGTAGTTGCCAACTA
TCTGTCCGCATCGGAGGAGGGCCAAACCGGCGGCTTCAGCAGCGCCTGCA
CTGCCATCGATGCGGTTTACACGTGGGTCAATGGCTCGGATCCCAACTTT
ATTGAGGACATCCGGCGATTCGATGACAAGTACGATCCCTCGCGGTTCGA
TGACAAGAATGAGCTGCGGTACTCTCTGAGGTCCCTGGAAAAACACGCCG
CATGGATCAGGCATGTGTACATAGTAACCAATGGCCAGATTCCAAGTTGG
CTGGATCTCAGCTACGAAAGGGTCACGGTGGTGCCCCACGAAGTCCTGGC
TCCCGATCCCGACCAGCTGCCCACCTTCTCCAGCTCGGCCATCGAGACAT
TTCTGCACCGCATACCAAAGCTGTCCAAGAGGTTCCTCTACCTCAACGAC
GACATATTCCTGGGAGCTCCGCTGTATCCGGAGGACTTGTACACTGAAGC
GGAGGGAGTTCGCGTGTACCAGGCATGGATGGTGCCCGGCTGCGCCTTGG
ATTGCCCCTGGACGTACATAGGTGATGGAGCTTGCGATCGGCACTGCAAC
ATTGATGCGTGCCAATTTGATGGAGGCGACTGCAGTGAAACTGGGCCAGC
GAGCGATGCCCACGTCATTCCACCAAGCAAAGAAGTGCTCGAGGTGCAGC
CTGCCGCTGTTCCACAATCAAGAGTCCACCGATTTCCTCAGATGGGTCTC
CAAAAGCTGTTCAGGCGCAGCTCTGCCAATTTTAAGGATGTTATGCGGCA
CCGCAATGTGTCCACACTCAAGGAACTACGTCGCATTGTGGAGCGTTTTA
ACAAGGCCAAACTCATGTCGCTGAACCCCGAACTGGAGACCTCCAGCTCC
GAGCCACAGACAACTCAGCGCCACGGGCTGCGCAAGGAGGATTTTAAGTC
TTCCACCGATATTTACTCTCACTCGCTGATTGCCACCAATATGTTGCTGA
ATAGAGCCTATGGCTTTAAGGCACGCCATGTCCTGGCGCACGTGGGCTTC
CTAATTGACAAGGATATTGTGGAGGCCATGCAGCGACGTTTTCACCAGCA
AATTCTGGACACTGCCCATCAGCGCTTCCGAGCCCCAACAGATTTGCAGT
ACGCATTCGCTTACTACTCCTTCCTAATGAGCGAAACCAAAGTAATGAGT
GTAGAGGAAATCTTCGATGAGTTCGACACGGACGGTTCGGCCACCTGGTC
GGATCGAGAGGTGCGAACCTTTCTCACTCGCATCTATCAGCCGCCACTTG
ACTGGTCTGCCATGCGCTACTTCGAGGAGGTGGTTCAAAACTGCACAAGA
AATCTGGGCATGCATTTAAAAGTGGACACAGTCGAACACTCCACGCTGGT
CTACGAGCGATACGAGGACTCTAATTTGCCTACAATAACCAGGGATTTGG
TTGTCCGATGTCCACTTCTGGCCGAAGCTTTGGCGGCAAACTTTGCAGTC
CGACCCAAATATAACTTCCATGTCAGCCCAAAAAGAACTTCGCACAGCAA
TTTTATGATGCTCACATCGAATCTCACGGAGGTGGTGGAGTCACTGGACC
GATTGCGTCGGAATCCGCGCAAGTTTAACTGCATCAACGACAATCTGGAT
GCCAATAGAGGCGAAGACAACGAGATGGTGCGCCATCTGCTCGAGGACTT
TTACCTCTCCTTCTTTCCGAGACGCAGCAAGTTCGAGCTGCCGCCGCAAT
ATCGTAATCGGTTCGAGTCCTGGCGGGACTTTCAGCGCTGGAAGAGAAGA
AAGCGGGCGGTTCTCGTGATTGGATATGGAGTGAGTCTGCTGCTTGTGGT
CTGTCTGCTGCGATTCATGTGCCACCACAAGGCGAAGCTGGTGAGGCGCT
GTGTGCAGCGCTTGGCAAGCTTTCTAGACCAT

BO26725.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG8027-RA 2001 CG8027-PA 1..1998 17..2014 9990 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG8027-RA 2597 CG8027-RA 101..2098 17..2014 9990 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9205452..9206872 1528..108 7105 100 Minus
2R 25286936 2R 9204909..9205395 2014..1528 2435 100 Minus
2R 25286936 2R 9206934..9207024 107..17 455 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:59:30 has no hits.

BO26725.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:08 Download gff for BO26725.complete
Subject Subject Range Query Range Percent Splice Strand
CG8027-RA 98..2095 17..2016 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:20 Download gff for BO26725.complete
Subject Subject Range Query Range Percent Splice Strand
CG8027-RA 101..2098 17..2016 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:43 Download gff for BO26725.complete
Subject Subject Range Query Range Percent Splice Strand
CG8027-RA 101..2098 17..2016 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:43 Download gff for BO26725.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9206934..9207024 17..107 100   Minus
2R 9205452..9206872 108..1528 100 <- Minus
2R 9204907..9205394 1529..2016 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:20 Download gff for BO26725.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5094439..5094529 17..107 100   Minus
arm_2R 5092957..5094377 108..1528 100 <- Minus
arm_2R 5092412..5092899 1529..2016 99 <- Minus

BO26725.pep Sequence

Translation from 16 to 2032

> BO26725.pep
MRLRRRWPRRMRRAMEQLRLQSRRKLLALTMTGGLCLAIWVVANYLSASE
EGQTGGFSSACTAIDAVYTWVNGSDPNFIEDIRRFDDKYDPSRFDDKNEL
RYSLRSLEKHAAWIRHVYIVTNGQIPSWLDLSYERVTVVPHEVLAPDPDQ
LPTFSSSAIETFLHRIPKLSKRFLYLNDDIFLGAPLYPEDLYTEAEGVRV
YQAWMVPGCALDCPWTYIGDGACDRHCNIDACQFDGGDCSETGPASDAHV
IPPSKEVLEVQPAAVPQSRVHRFPQMGLQKLFRRSSANFKDVMRHRNVST
LKELRRIVERFNKAKLMSLNPELETSSSEPQTTQRHGLRKEDFKSSTDIY
SHSLIATNMLLNRAYGFKARHVLAHVGFLIDKDIVEAMQRRFHQQILDTA
HQRFRAPTDLQYAFAYYSFLMSETKVMSVEEIFDEFDTDGSATWSDREVR
TFLTRIYQPPLDWSAMRYFEEVVQNCTRNLGMHLKVDTVEHSTLVYERYE
DSNLPTITRDLVVRCPLLAEALAANFAVRPKYNFHVSPKRTSHSNFMMLT
SNLTEVVESLDRLRRNPRKFNCINDNLDANRGEDNEMVRHLLEDFYLSFF
PRRSKFELPPQYRNRFESWRDFQRWKRRKRAVLVIGYGVSLLLVVCLLRF
MCHHKAKLVRRCVQRLASFLDH

BO26725.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG8027-PA 666 CG8027-PA 1..666 1..666 3527 100 Plus