Clone BO26729 Report

Search the DGRC for BO26729

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:29
Vector:pDNR-Dual
Associated Gene/TranscriptCG10073-RA
Protein status:BO26729.pep: Imported from assembly
Sequenced Size:2653

Clone Sequence Records

BO26729.complete Sequence

2653 bp assembled on 2010-09-13

GenBank Submission: KX794534

> BO26729.complete
GAAGTTATCAGTCGACATGGGTGACAAAGACAAACTGATTTCTGATGAGC
CAATCGAAGATGCCGTTAGATCGGCATCCTCTAAAAAAATCAAAAACCAG
GAACAATACTTACGAGGACCCTGGTATTTGGCCACTGGTTTTCTACTGTT
TTGGGCACTCCTCTTCTCGGCCGTGGTATTACCACTCTTTTACCGCATTC
CCACAGGATTGACCATTGAGGATGCATCCAAGGGCGTCTTTATCGCCGAA
CGAGCCCAAAGCAATCTTTACAAATTAGCCGAAATCGGTACCAAAGTCGT
TGGCAGTGATAACAATGAGAACAAAACTGTTGACTATCTGATGGGTCTAG
TGAACGAGATACAGGAGAATTGCCTGGATGACTACTTCGACATCGAAGTC
GATTTGCAAGAGGTCTCGGGATCCTATATTCATTGGACCATGGTCAATAT
GTACCAGGGCGTTCAGAATATTGTGATCAAACTGAGTCCCAAGAATACCA
CGAGTACCACTTACCTGCTCGTCAACAGTCACTTCGATTCCAAGCCGACT
AGTCCATCTGCTGGCGATGCTGGTCAGATGGTTGTTGCCATCCTGGAGGT
CCTGCGAGTGATGTGCTCAACCAAGCAAGCCATTAGGCATCCAGTCGTCT
TTCTACTGAACGGAGCCGAGGAGAATCCACTACAAGCTTCGCATGGCTTC
ATTACCCAACACAAATGGGCTAAAAACTGCAAGGTGGTTCTCAATTTGGA
TGCAGCTGGCAATGGCGGTAGTGATATAGTGTTCCAAACTGGACCTAATA
GCCCTTGGCTTGTAGAAAAATACAAAGAAAATGCACCACACTATCTGGCT
ACCACAATGGCTGAGGAAATCTTCCAAACAGGCATCCTGCCCTCCGACAC
TGATTTTGCTATCTTTGTCAAGTATGGTAATCTTATTGGTTTGGACATGG
CCAAGTTTATCAATGGTTTCGCCTATCACACCAAGTACGATCAATTCTCC
AATATTCCCAGAGGATCCATACAAAATACGGGCGATAATTTGCTTGGTCT
GGTGCGATCCATAGCCAATTCTACGGAACTGGATAACACAGAGGCTTATG
CCACAGGACATGCCATCTTTTTCGATGTCCTGGGACTGTACTTCATTAGC
TATACGGAGAGCAATGGCGTTATTCTCAATTATTCCGTGGCCGGAGTGGC
ACTTGTCCTGATTTTCTTATCCATTTGGCGTACATCAAGCATATCCCGTG
TGTCCATAGGACACGTTCTCTGCTGGTTCATTTTGATCTTTGTGCTGCAG
ATCATAGCTTTTGTACTGGGACTCGGACTGCCCATAGTCGTAGCCTATGT
TTTCGATAAGTACGGACTATCCATCACTTACTTCAGCACTCCAGTCCTGC
TAATTGGCCTCTATATTTGCCCGAGTCTATTGGGATTGAGCTTGCCATCC
TACATCTACCTGAAGTTGCAACGAAGTGAAAAGGTCGGATTCGCCCAACA
TCTGCAGCTGGTTCTCCATGGACACGCTGCAGTGCTGGCTATCTTGGACA
TTGGATTGACCGTTTATGGACTGCGTAGCGCCTATGTGCCCACCTGGACA
CTCATCTTCTACGTCATTCCCTTGGCCGTCAATCTGTTGACCACTTTGCA
TGATCGCGGCTTTTCCTGGACCGGTGTGCTCAAGATATTCCAAGTAGTTC
CCTTCCTTTACAATAGCTATTTGATTTACTGTTTCGTGGTGACTCTCATA
CCCATGATGGGTCGTTTTGGCCGAGCAACTAATCCGGATTTGATTATATC
GGCTTTGTGTGCTTTGGGAACCATTTTGGCTTTGGGTTTCGTGATACCCC
TAGTTAACATGTTCCGACGCCCCAGTCTGATCCTGCTCACCTTGTTGGCC
ATAAGCGCTGTGACCATTTACACGGCTAGCTCCACCCAAATTGGTTTTCC
ATACCGTCCAAAGACCAACGTTCAGCGACTTCCCTACCTGCATGTACGAC
GAATCTTCTACGAATACGATGGCACAGTTGTGAAGAATGACTCCGGCTAT
CTGTTCAACTTCCAGGATCGTCGGGGACCAGCACCCCTGAAACTGTCCAA
GTTGAATACGACTGGATTGGTCAGCATTGCTGCGGACTGTGATACGGTTA
TGATGTGCGGATTTCCTCTATATGATCACCGATGGGTTAAGAATCGTCTG
CAGATAATGTGGCTGCCAAGAGAAGAGGAAATCATTACGCCATATGAGCC
GAAACTTGAGCTATTGTCCAAAACGGAACTGGGAAACAATACACTGCGCA
TGAATTTCCAATCAGCGACTACGGATCATGCCAGTGTGTTTATCCAGCCA
CTTGAAGATGTTATCATTTCCAACTGGAGCCTGCCCACGAGTTACATTGG
CCAGCAGGATACCTCCCATATGTACTTCTCATATGGCAAGAACAACACGG
CATTGACTTTCTTTATTGACTTTTATAAACTGGATGCCGACTTTGCCGTA
CCCTTGTGTCAGATCGGATTGGCTGTCCATTTTATTGGCAACAAAGGCGA
TGCAATCAGTCAGGAGTTTGCCAAGAAGATACCATCATTTGCCGCTGCAG
TGGATTGGCCAGCTTCCTACCAACGTTACATTTTCGCAAGCTTTCTAGAC
CAT

BO26729.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG10073-RA 2622 CG10073-PA 1..2619 17..2635 13095 100 Plus
CG10073-RC 2646 CG10073-PC 45..2643 37..2635 12995 100 Plus
CG10081-RB 2622 CG10081-PB 425..976 441..992 480 72.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG10073-RA 2751 CG10073-RA 57..2675 17..2635 13095 100 Plus
CG10073-RC 2747 CG10073-RC 73..2671 37..2635 12995 100 Plus
CG10081-RB 2732 CG10081-RB 470..1021 441..992 480 72.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19381755..19382451 37..733 3485 100 Plus
2R 25286936 2R 19384182..19384668 1990..2476 2435 100 Plus
2R 25286936 2R 19383044..19383430 1092..1478 1935 100 Plus
2R 25286936 2R 19383489..19383784 1478..1773 1480 100 Plus
2R 25286936 2R 19384731..19384889 2477..2635 795 100 Plus
2R 25286936 2R 19382839..19382995 938..1094 785 100 Plus
2R 25286936 2R 19383978..19384125 1843..1990 740 100 Plus
2R 25286936 2R 19382654..19382776 818..940 615 100 Plus
2R 25286936 2R 19382511..19382595 733..817 425 100 Plus
2R 25286936 2R 19383834..19383912 1765..1843 365 97.5 Plus
2R 25286936 2R 19387854..19388131 1493..1770 280 73.4 Plus
2R 25286936 2R 19359536..19359845 424..733 260 72.3 Plus
2R 25286936 2R 19377602..19377688 647..733 240 85.1 Plus
2R 25286936 2R 12360234..12360330 637..733 215 81.4 Plus
2R 25286936 2R 12356445..12356532 633..720 185 80.7 Plus
Blast to na_te.dros performed 2014-11-28 08:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 2935..2998 332..396 115 66.2 Plus

BO26729.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:03 Download gff for BO26729.complete
Subject Subject Range Query Range Percent Splice Strand
CG10073-RA 61..2679 17..2637 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:10 Download gff for BO26729.complete
Subject Subject Range Query Range Percent Splice Strand
CG10073-RA 57..2675 17..2637 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:36 Download gff for BO26729.complete
Subject Subject Range Query Range Percent Splice Strand
CG10073-RA 57..2675 17..2637 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:36 Download gff for BO26729.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19384731..19384889 2477..2637 98   Plus
2R 19384183..19384668 1991..2476 100 -> Plus
2R 19383979..19384125 1844..1990 100 -> Plus
2R 19383843..19383912 1774..1843 100 -> Plus
2R 19383489..19383784 1478..1773 100 -> Plus
2R 19383046..19383429 1094..1477 100 -> Plus
2R 19382840..19382994 939..1093 100 -> Plus
2R 19382654..19382774 818..938 100 -> Plus
2R 19382511..19382595 733..817 100 -> Plus
2R 19381756..19382450 38..732 100 -> Plus
2R 19381676..19381696 17..37 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:10 Download gff for BO26729.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15272236..15272394 2477..2637 98   Plus
arm_2R 15271688..15272173 1991..2476 100 -> Plus
arm_2R 15271484..15271630 1844..1990 100 -> Plus
arm_2R 15271348..15271417 1774..1843 100 -> Plus
arm_2R 15270994..15271289 1478..1773 100 -> Plus
arm_2R 15270551..15270934 1094..1477 100 -> Plus
arm_2R 15270345..15270499 939..1093 100 -> Plus
arm_2R 15270159..15270279 818..938 100 -> Plus
arm_2R 15270016..15270100 733..817 100 -> Plus
arm_2R 15269261..15269955 38..732 100 -> Plus
arm_2R 15269181..15269201 17..37 100 -> Plus

BO26729.pep Sequence

Translation from 16 to 2653

> BO26729.pep
MGDKDKLISDEPIEDAVRSASSKKIKNQEQYLRGPWYLATGFLLFWALLF
SAVVLPLFYRIPTGLTIEDASKGVFIAERAQSNLYKLAEIGTKVVGSDNN
ENKTVDYLMGLVNEIQENCLDDYFDIEVDLQEVSGSYIHWTMVNMYQGVQ
NIVIKLSPKNTTSTTYLLVNSHFDSKPTSPSAGDAGQMVVAILEVLRVMC
STKQAIRHPVVFLLNGAEENPLQASHGFITQHKWAKNCKVVLNLDAAGNG
GSDIVFQTGPNSPWLVEKYKENAPHYLATTMAEEIFQTGILPSDTDFAIF
VKYGNLIGLDMAKFINGFAYHTKYDQFSNIPRGSIQNTGDNLLGLVRSIA
NSTELDNTEAYATGHAIFFDVLGLYFISYTESNGVILNYSVAGVALVLIF
LSIWRTSSISRVSIGHVLCWFILIFVLQIIAFVLGLGLPIVVAYVFDKYG
LSITYFSTPVLLIGLYICPSLLGLSLPSYIYLKLQRSEKVGFAQHLQLVL
HGHAAVLAILDIGLTVYGLRSAYVPTWTLIFYVIPLAVNLLTTLHDRGFS
WTGVLKIFQVVPFLYNSYLIYCFVVTLIPMMGRFGRATNPDLIISALCAL
GTILALGFVIPLVNMFRRPSLILLTLLAISAVTIYTASSTQIGFPYRPKT
NVQRLPYLHVRRIFYEYDGTVVKNDSGYLFNFQDRRGPAPLKLSKLNTTG
LVSIAADCDTVMMCGFPLYDHRWVKNRLQIMWLPREEEIITPYEPKLELL
SKTELGNNTLRMNFQSATTDHASVFIQPLEDVIISNWSLPTSYIGQQDTS
HMYFSYGKNNTALTFFIDFYKLDADFAVPLCQIGLAVHFIGNKGDAISQE
FAKKIPSFAAAVDWPASYQRYIFASFLDH

BO26729.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG10073-PA 873 CG10073-PA 1..873 1..873 4531 100 Plus
CG10073-PC 881 CG10073-PC 16..881 8..873 4494 100 Plus
CG10081-PA 875 CG10081-PA 1..875 1..873 2877 61.7 Plus
CG10081-PB 873 CG10081-PB 1..873 1..873 2854 61.5 Plus
CG30047-PA 879 CG30047-PA 31..879 33..873 2201 49.2 Plus