Clone BO26732 Report

Search the DGRC for BO26732

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:32
Vector:pDNR-Dual
Associated Gene/Transcriptpav-RA
Protein status:BO26732.pep: Imported from assembly
Sequenced Size:2695

Clone Sequence Records

BO26732.complete Sequence

2695 bp assembled on 2010-09-13

GenBank Submission: KX796534

> BO26732.complete
GAAGTTATCAGTCGACATGAAGGCAGTACCCAGGACGCCGATGCGTGTCG
TCCCGAAAACTCCGCGGGTGCATCAAACGGTGGAGAAACAGCGACGAGAC
ACCTCCGACAAGGCCAGGGATCCAGTGAATGTGTTCTGTCGAGTGCGGCC
ACTACAATCCGACGCAGATCTCACCTCCCTAAGGGTCAAGAACTCCACGA
CGATCGCACTGAATCCGCAGGATCAGCTGCTGCAGCATCACAAGCCACAC
AACGGCGCCCAGCGCGAGGTTCAGTACATATTCAAGCACGTTTTCCAGCC
GGATGCCACGCAGCAGGATGTGTACGCAGCTGTGGCCCAGCCGTTGGTGG
AGAACCTACTGAAAGGCCGAAACAGTCTGCTTTTCACCTACGGCGTGACT
GGAAGTGGAAAAACGTACACCATGACCGGCAACCTGCGACACCGCGGCAT
CATGCCGCGCTGCCTGGACGTGCTCTTTCGCACCATTTCAGATTACCAGG
CCAAGAAGTTCGTCTTCAAGCCGGACAAGCTTAATGGCTTCGAGATCCTG
TCCGAAGAGGATGCGCTTTTGGAGCGCCAACACGAGATGAACCAGCGTTT
TGCTGGCTCAGGACGATTTGCCTTCAGGCACAAGGACTCGGATCCGGAAA
TTGCATCCCAGGCCTCCGTGGAGCCAATTCCGCTGCTGGGTTTGGATGAG
GACAACATGTACTCGGTGTTTGTCACCTATATTGAAATTTACAATAACAG
CGTCTACGACCTCCTTGAGGACTCGGGTATACAGAAGACTTTGCAGAGCA
AAATCATTCGTGAAGATGCCAATCGACACATGTTCGTCCACGGCGTCACA
GAGGTGGAGGTCAAGACCGTGGAGGACGCCCTCGAGGTCTTTCAAATGGG
CCAGAAGCGCAAACGAATGGGACACACTGTTCTCAATGCAGAATCCAGTA
GGAGTCACTCGGTGTTCAATATACGCTTGGTGCAGGCGCCCACTGATAGC
CAGGGTGAGAATGTGGTTCAGGACCGGCAAAACATCACAGTGAGTCAACT
GTCCCTGGTGGATCTGGCGGGCAGTGAGCGATCCTCAAGGACCAAGAACA
CCGGTGTGCGACTCCGTGAGGCGGGCAACATCAATAATTCGCTGATGACG
CTGCGCACTTGCCTGGAATATCTGCGCGAGAACCAACTCGCGGCTAGCAA
TGGATTGGCACCCAAGAAGGTCCCCTATCGAGACTCCAAGATCACACACA
TGTTTAAAAACTACTTCGATGGCGAAGGCCAGGTGTCCATGATTGTGTGC
ATCAACCCAAGAATTGAGGACTATGATGAGAATATGCAAGTGATGAAGTT
CGCCGAGATGACCCAGGAGGTGCAAATTGCTCGGGCGACTCCTATGAAGC
AAGATTTGGGTCTGACTCCCGGCCGTCGCAAGGCCAACAAGCTGTTCAAG
ATTGCCGTTAATAATCTAAACGAGCTGGGCATTCCTGAGGCCAAGGATTT
GGAGGTGGACGTGGGTTTGGTGTACAGTTTGGGACCCGATTTTCCCGCCT
ACGAAATGGACAGTCCCGAGGCACAGATCAAAATCCGCGAGCTAATGCAT
TATCTGGAGCAGCGCATAGAAAAGCGAAAGAAGCTGCGTGCCAACTTGGA
CATTAAATGTGACAGCTTCCGGCAGATGCTGATGAACCTTGACCGCGACA
ATCTTCAGCTGCGCACGGAGCTCGCCTCCTTAAAGGCTGTTTACAAGCAG
GAGCGCGATCGCAGTGCGGCACTCGAGAAGAAGGTTCGCATCCACGAGAG
CTCCATTGACGTGCTTAACAATACGCTAAGCAAGCAAGAACGGCAGATTG
AAGAGCTGACTTTCAAGCTGAACGAGAAGGAGAATATGCTCACCCAAAAG
GAGCACGAGAAGGAAAAGCAAAAGAAGAAGTTCAGCTCCAAGCTGGCCGT
TGAGTCGGACAAAAATAAGCGAGAGTTTGAACTAAAGCTGCGTGAACAGC
GAGTGAAATTGCAGGAACGCATGCGCATCAAGGACGAGAAGTTGCGATTG
GTCTCCAACATTCTGCAGTCCGAAGATCTGCCCAGTTTGCCGCGGTCACA
GAGCTCGGAAAACATACTTAATGAGAAAGATCGCGGTGCATATACGGCGC
GCACGGAGGAGTCCTCGGTGCCAGCTACACGAACAGATATATATGCAACG
CCACGTCATGGTGCAGCAGCGGCCAACAATCGGCATAGACGCTCTCGATC
CGCAGGCGACAAGTGGCTGGAGCATCGGGCAGCTAATCCCGTTCCGCTTG
GCACTATTATGCAGCCGTATCTGAAGAATCGCAAATCCGTAACGAAACTA
ACCGACTTGAAGGAGTTGACTGCTCACGGAACTACGAAGTACTGTCTCGT
CTCGCAGGATGCGGATACGGATGGCGATGTGGAGACGAAGCTGTATAAGG
GCAATGTAATTCCCACTTGTGGCGGTGGTGCCCAAGTTGTGTTCAACGAT
GTGGAGTGCCTCAAGCAGAAGTCACCGGTTCACTCGCCCACGCGAAAGCG
ACCCAGCAATGGCAACATTTCGGCTCTGGGCGGCGGTGCAGTGCCCAGCA
CGGTCACCTCAGCCCAGGACGTAGCCTCCCGCTGCAATCTCGGCATTGAG
GGACACAGCAGCAAGAAGTCGAAAATCGCAAGCTTTCTAGACCAT

BO26732.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
pav-RA 2664 CG1258-PA 1..2661 17..2677 13305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
pav-RA 3207 CG1258-RA 143..2805 15..2677 13315 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4242948..4243707 28..787 3800 100 Plus
3L 28110227 3L 4244752..4245303 1659..2210 2760 100 Plus
3L 28110227 3L 4243765..4244314 787..1336 2750 100 Plus
3L 28110227 3L 4245364..4245831 2210..2677 2340 100 Plus
3L 28110227 3L 4244374..4244698 1336..1660 1625 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:58:53 has no hits.

BO26732.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:02 Download gff for BO26732.complete
Subject Subject Range Query Range Percent Splice Strand
pav-RA 143..2803 17..2679 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:07 Download gff for BO26732.complete
Subject Subject Range Query Range Percent Splice Strand
pav-RA 145..2805 17..2679 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:34 Download gff for BO26732.complete
Subject Subject Range Query Range Percent Splice Strand
pav-RA 145..2805 17..2679 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:34 Download gff for BO26732.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4245364..4245831 2210..2679 99   Plus
3L 4244752..4245302 1659..2209 100 -> Plus
3L 4244375..4244696 1337..1658 100 -> Plus
3L 4243765..4244314 787..1336 100 -> Plus
3L 4242940..4243706 17..786 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:07 Download gff for BO26732.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4245364..4245831 2210..2679 99   Plus
arm_3L 4244752..4245302 1659..2209 100 -> Plus
arm_3L 4244375..4244696 1337..1658 100 -> Plus
arm_3L 4243765..4244314 787..1336 100 -> Plus
arm_3L 4242940..4243706 17..786 99 -> Plus

BO26732.pep Sequence

Translation from 16 to 2695

> BO26732.pep
MKAVPRTPMRVVPKTPRVHQTVEKQRRDTSDKARDPVNVFCRVRPLQSDA
DLTSLRVKNSTTIALNPQDQLLQHHKPHNGAQREVQYIFKHVFQPDATQQ
DVYAAVAQPLVENLLKGRNSLLFTYGVTGSGKTYTMTGNLRHRGIMPRCL
DVLFRTISDYQAKKFVFKPDKLNGFEILSEEDALLERQHEMNQRFAGSGR
FAFRHKDSDPEIASQASVEPIPLLGLDEDNMYSVFVTYIEIYNNSVYDLL
EDSGIQKTLQSKIIREDANRHMFVHGVTEVEVKTVEDALEVFQMGQKRKR
MGHTVLNAESSRSHSVFNIRLVQAPTDSQGENVVQDRQNITVSQLSLVDL
AGSERSSRTKNTGVRLREAGNINNSLMTLRTCLEYLRENQLAASNGLAPK
KVPYRDSKITHMFKNYFDGEGQVSMIVCINPRIEDYDENMQVMKFAEMTQ
EVQIARATPMKQDLGLTPGRRKANKLFKIAVNNLNELGIPEAKDLEVDVG
LVYSLGPDFPAYEMDSPEAQIKIRELMHYLEQRIEKRKKLRANLDIKCDS
FRQMLMNLDRDNLQLRTELASLKAVYKQERDRSAALEKKVRIHESSIDVL
NNTLSKQERQIEELTFKLNEKENMLTQKEHEKEKQKKKFSSKLAVESDKN
KREFELKLREQRVKLQERMRIKDEKLRLVSNILQSEDLPSLPRSQSSENI
LNEKDRGAYTARTEESSVPATRTDIYATPRHGAAAANNRHRRSRSAGDKW
LEHRAANPVPLGTIMQPYLKNRKSVTKLTDLKELTAHGTTKYCLVSQDAD
TDGDVETKLYKGNVIPTCGGGAQVVFNDVECLKQKSPVHSPTRKRPSNGN
ISALGGGAVPSTVTSAQDVASRCNLGIEGHSSKKSKIASFLDH

BO26732.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
pav-PA 887 CG1258-PA 1..887 1..887 4528 100 Plus
sub-PB 628 CG12298-PB 80..479 28..452 429 30.5 Plus
sub-PA 628 CG12298-PA 80..479 28..452 429 30.5 Plus
Klp31E-PE 1047 CG5300-PE 14..561 37..703 390 25.4 Plus
Klp31E-PC 1048 CG5300-PC 14..559 37..688 390 25.1 Plus