Clone BO26740 Report

Search the DGRC for BO26740

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:40
Vector:pDNR-Dual
Associated Gene/TranscriptACXD-RA
Protein status:BO26740.pep: Imported from assembly
Sequenced Size:3520

Clone Sequence Records

BO26740.complete Sequence

3520 bp assembled on 2010-09-16

GenBank Submission: KX794030

> BO26740.complete
GAAGTTATCAGTCGACATGGACTCCTACTTCGACTCGGCCATCGAGTACA
ATCGATCCAACCCCATCAGCCTGGCCAGGACCAGCAGCCAGGCCCAAACC
GTGCAGAACGAGAAGAACTGGGAGTGGTCGTACCTTGTGAGAAAATGTCG
CAACCTGGAGCTGGAGGACTCGTACGACCTATACATGCGTCGCCTGCGCG
TCGGCTACCTGTCGCTGTTCATCTTCATCCACGTGGCGGTGACGGTGATC
CACACGCTGCTGCTGCTGACCACGCCGGAGATCAAGTACGTGTACGTGGA
CATGGTGGCCTACATGTGCTCCGGCCTGGTCATCTGGGTGGTGCTGGGCG
TGAACTTTCGCAGCGAGCTGGTGAGCAAGCACGGCTGGGTGGTCTACGCC
ACCTCCTGGCTGGCGGTGTGTGTAATGGTCCTGATGGACATCGGACTGAA
TGTTTACCACGCCACCAGCCACAACGACATCCTGAATCCGATCTACGATG
CGTATACGCTGTACGCCATATACATGTTCATGCCGGTGCCGTACCTGCTG
CAGCCGTTTGTCCTTGGATCGGCAGTCACCTTTTGCTACATAATAAACTA
CAGCTTCGTGATCACCGCCAAGGATGACAACCAAATGCACAGCATCCTGA
ACGAGGCCATATACCTGAGCTGTGTCAACCTACTGGGCATTTTCTTTCGC
CTGATGAGGGATATAGCGCTACGCACCACCTTCCTCGATCGCCGGCAGTA
TGTGGAGGAGAATCTCCTGTTGCGCTATGCCAGGGATCAGGAGCGGAGTC
TCTTGCTTAGCATCCTGCCTGCCCAGATCGCCGATCGGCTGCAGGAGGAT
GTGAAGAACCGCATCGAGCGATCCAAGCAGCAGCACCAGCAGCAGTCGCA
GGTGGATCTGCGCAGGAGTGCGGATAGCCAGACCCTTAAAAGGTGGCGAC
AACCGGACCATGGCACCCTCTTCATTGAGCCCCACGAAGATGTCACCGTC
CTCTACGCGGATGTGGTCAACTACACCCACTTGACCACCACCCTGGATGT
GAAGAAGCTAGTGGAGGCTCTGCACGATCTCTTCGTGCGTTTCGACATTG
CCAGCGAGGAGTACAACGTGCTGAGGATCAAGTTCCTGGGCGATTGCTAC
TACTGCGTGGCTGGGCTGGCCAATCCCAATGCGGATCACGCCAAGTGCTG
CGTGGATCTGGGACTGCGTATGATCAAGGACATTCGAGATGTCAGAGAGA
AGCGCCATCTGAATATCGACATGCGAATCGGCGTCCACTCGGGCGATGTC
CTATCCGGCGTAATTGGAGCCGCCAAGTGGCAGTTTGACATATGGTCGAA
GGACGTGGATATTGCCAATCGCCTGGAGGCCACTGGAGCCACAGGACGAG
TGCATGTGAGCCAGAAGACCCTATCCCTGCTGGATGGCGAGTACTTCTTC
GAGGACGGCACCGAAAAGGCTCGAGAGGATCCGGTGCTGCAGAAGCACGG
CATTCGCACCTTCCTTATCAAGTCACTGCGCGCCCCCATGCATGACCCGC
GTCGCAGGATGAGGGAGCGGCAGGTGAAGAAGCTGAGCGAGGCCAGCAAG
GCCAACTTTATGCACAACTCCACGCTCCACCAGTACAACCAGGTGCGCAA
CCAGGCCAAGCTGGAGATGTGTCGCGAGCTGGACAAGATGCCCATCGGCA
GGATACAGCTCACCAAAGTCTTCCGGCGAAGCACTCGGCTCACCCAGGAC
GAAATCGAAGAAGAGACCTTTCGACGCAACATCAGCTCCTGCTGTCTGTT
CTTTCGCATCCGCAACTGGGAGTTCCAGTATATCAAGGAGCCGGATGTGA
TGCTCAAGTACAGCATTGCTTTGGCTTGGGTCATTTACATGGGTCTGCTG
ACCATCCAGCTGCTGAGCAAGGATGCTCGCTATCACTACTGGTACATAGA
TGGCACCACGATTATCCTGCTCACCATGCTGCTGATCGTGTCCTGGTACA
AGAAGCTCTGGATCATGTACATGTCCGATGCGGATGTGTCCTCGCCGAAC
GGCCGGCTCAGTGGCTTCCTCTTCCGCATGTCGGATGAGATGCAGCGCAA
TGTGGTCATCCGGGTGGTGATGTACTTCCTGATCATCTTCTCCTATTGCG
CGGTGGCCATTATGCAAGTGGTGGGATGCAGCAGTGACGAGGACTACGCG
GATCTGGATCCGACCTACGACGAGCGGGTTCAGTGCTTTCATCCTTGGAT
ACTCACCAATTGCATGACCCTGGTAATTGGCATGTCCTTCCTCTTCACGC
GAATCCCCTTCATCATCAAGTCCTGCTTCTCTGCTTTGATAATGATCGGC
TACGCGGTGCTGGTGGTGTCCGAGTTCAACTTCATCTACGCCAACAGCCC
CTCCACCAATGTGAACTTCAACGCCAAGTACTCGCATATCCTGCTGATGA
TCATAACGTTCGGCATTTTTCACTTGATGGAGCGGCAGACGGAGTTCATT
GCCAAAGTGGATTACAACTGGAAACGGCAGCTAATTAAGAAGCAGGAGGA
CGCCCTGATCACCAATGACACCATTAAAGTGCTCCTCACCAATATTCTGC
CCACACATGTTGCCGACTTCTATCTGTCAAATCAACTGCAGAACGAGCTC
TACTACGAGGAGTACGATAATGTGGCCGTGATGTTCGCCTCGATCAAAAA
CTTCGACACCGACAAGATCGGACTGCGGGTGCTCAATGAGATTATCTGCG
ACTTTGACGATGTGTTGAACAAGTACTCGCAGAGTCTGCGCGTGGAGAAG
ATCAAGGTGGCCAACTGGACGTACATGGCGGCCTGTGGCCTAGACGTCTC
TCGTTCGGAGCAGGTGAACGCCCCGCAGATGAAGTTCCGCAACGTTTCCC
TCATGCCCAACGGGCGCAGGAGTCGCTACGACGGAGCACGAAGCTCCAAT
GCGGACGGAGTGCAGCGGGTGCCGTACGGAAACGGCAGCAACATAGCCCT
GGATCTCGACTTGGAGCGGGGTCAGTACGAGGGCAACGTGATCACCAGCG
GGCCGCGCATCAGTAGCACCCACAACGGGAGCAGCAGCAACGAGGTGGTG
CGCGTGATGGCCGAGTTCGCCCTGGACCTGATGCGCACGATGCGCCGCTT
CAACACGGAGAACATGCAGACGGAGTACGAGGGCAGCACCGACTACGGCA
TGCTGAGGATCGGCATCTCGCACGGCAGGGCCATGGCCGGGGTGGTGGGC
ATCTCGAAGCCCCACTATGACATCTGGGGCAATCCCGTGAACATGGCCTC
GCGCATGGACTCCACCGGCGTGCCCGGCCAGATTCAGGTCACCGAGAACA
CGGCGCTTAAGCTGCGCGAGTTTAACATTCAGTGCAACTACCGCGGCATG
ACCTTCGTCAAGGGGCGTGGCAACATTCCCACCTACATCATCGGCATCGA
CAGCGAATACCAGTTCCTGCCACATCGCCCGGCCGCGCCAACCAAAGAAG
ACGCAAGCTTTCTAGACCAT

BO26740.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
ACXD-RA 3489 CG5712-PA 1..3486 17..3502 17415 100 Plus
ACXD-RB 1521 CG5712-PB 1..1515 17..1531 7575 100 Plus
rut-RF 4524 CG9533-PF 3037..3108 3257..3328 195 84.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
ACXD-RA 4112 CG5712-RA 526..4012 16..3502 17420 100 Plus
ACXD-RB 4118 CG5712-RB 526..4018 16..3502 17325 99.8 Plus
rut-RF 7905 CG9533-RF 3415..3486 3257..3328 195 84.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2239092..2239916 139..963 4125 100 Plus
3L 28110227 3L 2242881..2243619 2764..3502 3695 100 Plus
3L 28110227 3L 2241619..2241943 1924..2248 1625 100 Plus
3L 28110227 3L 2240757..2241045 1244..1532 1445 100 Plus
3L 28110227 3L 2239978..2240260 963..1245 1415 100 Plus
3L 28110227 3L 2242004..2242273 2248..2517 1350 100 Plus
3L 28110227 3L 2241348..2241563 1708..1923 1080 100 Plus
3L 28110227 3L 2241110..2241286 1532..1708 885 100 Plus
3L 28110227 3L 2242483..2242639 2612..2768 755 98.7 Plus
3L 28110227 3L 2238427..2238550 16..139 620 100 Plus
3L 28110227 3L 2242335..2242429 2518..2612 475 100 Plus
X 23542271 X 14794274..14794345 3328..3257 195 84.7 Minus
2L 23513712 2L 12929387..12929469 3233..3315 190 81.9 Plus
Blast to na_te.dros performed 2014-11-28 05:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6784..6844 3033..3093 125 67.2 Plus

BO26740.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-17 10:26:23 Download gff for BO26740.complete
Subject Subject Range Query Range Percent Splice Strand
ACXD-RA 525..4010 17..3504 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:27:06 Download gff for BO26740.complete
Subject Subject Range Query Range Percent Splice Strand
ACXD-RA 527..4012 17..3504 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:15:18 Download gff for BO26740.complete
Subject Subject Range Query Range Percent Splice Strand
ACXD-RA 527..4012 17..3504 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:15:18 Download gff for BO26740.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2242882..2243619 2765..3504 99   Plus
3L 2242484..2242635 2613..2764 99 -> Plus
3L 2242335..2242429 2518..2612 100 -> Plus
3L 2242005..2242273 2249..2517 100 -> Plus
3L 2241619..2241943 1924..2248 100 -> Plus
3L 2241348..2241563 1708..1923 100 -> Plus
3L 2241110..2241285 1532..1707 100 -> Plus
3L 2240759..2241044 1246..1531 100 -> Plus
3L 2239979..2240260 964..1245 100 -> Plus
3L 2239093..2239916 140..963 100 -> Plus
3L 2238428..2238550 17..139 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:27:06 Download gff for BO26740.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2242882..2243619 2765..3504 99   Plus
arm_3L 2242484..2242635 2613..2764 99 -> Plus
arm_3L 2242335..2242429 2518..2612 100 -> Plus
arm_3L 2242005..2242273 2249..2517 100 -> Plus
arm_3L 2241619..2241943 1924..2248 100 -> Plus
arm_3L 2241348..2241563 1708..1923 100 -> Plus
arm_3L 2241110..2241285 1532..1707 100 -> Plus
arm_3L 2240759..2241044 1246..1531 100 -> Plus
arm_3L 2239979..2240260 964..1245 100 -> Plus
arm_3L 2239093..2239916 140..963 100 -> Plus
arm_3L 2238428..2238550 17..139 100 -> Plus

BO26740.pep Sequence

Translation from 16 to 3520

> BO26740.pep
MDSYFDSAIEYNRSNPISLARTSSQAQTVQNEKNWEWSYLVRKCRNLELE
DSYDLYMRRLRVGYLSLFIFIHVAVTVIHTLLLLTTPEIKYVYVDMVAYM
CSGLVIWVVLGVNFRSELVSKHGWVVYATSWLAVCVMVLMDIGLNVYHAT
SHNDILNPIYDAYTLYAIYMFMPVPYLLQPFVLGSAVTFCYIINYSFVIT
AKDDNQMHSILNEAIYLSCVNLLGIFFRLMRDIALRTTFLDRRQYVEENL
LLRYARDQERSLLLSILPAQIADRLQEDVKNRIERSKQQHQQQSQVDLRR
SADSQTLKRWRQPDHGTLFIEPHEDVTVLYADVVNYTHLTTTLDVKKLVE
ALHDLFVRFDIASEEYNVLRIKFLGDCYYCVAGLANPNADHAKCCVDLGL
RMIKDIRDVREKRHLNIDMRIGVHSGDVLSGVIGAAKWQFDIWSKDVDIA
NRLEATGATGRVHVSQKTLSLLDGEYFFEDGTEKAREDPVLQKHGIRTFL
IKSLRAPMHDPRRRMRERQVKKLSEASKANFMHNSTLHQYNQVRNQAKLE
MCRELDKMPIGRIQLTKVFRRSTRLTQDEIEEETFRRNISSCCLFFRIRN
WEFQYIKEPDVMLKYSIALAWVIYMGLLTIQLLSKDARYHYWYIDGTTII
LLTMLLIVSWYKKLWIMYMSDADVSSPNGRLSGFLFRMSDEMQRNVVIRV
VMYFLIIFSYCAVAIMQVVGCSSDEDYADLDPTYDERVQCFHPWILTNCM
TLVIGMSFLFTRIPFIIKSCFSALIMIGYAVLVVSEFNFIYANSPSTNVN
FNAKYSHILLMIITFGIFHLMERQTEFIAKVDYNWKRQLIKKQEDALITN
DTIKVLLTNILPTHVADFYLSNQLQNELYYEEYDNVAVMFASIKNFDTDK
IGLRVLNEIICDFDDVLNKYSQSLRVEKIKVANWTYMAACGLDVSRSEQV
NAPQMKFRNVSLMPNGRRSRYDGARSSNADGVQRVPYGNGSNIALDLDLE
RGQYEGNVITSGPRISSTHNGSSSNEVVRVMAEFALDLMRTMRRFNTENM
QTEYEGSTDYGMLRIGISHGRAMAGVVGISKPHYDIWGNPVNMASRMDST
GVPGQIQVTENTALKLREFNIQCNYRGMTFVKGRGNIPTYIIGIDSEYQF
LPHRPAAPTKEDASFLDH

BO26740.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
ACXD-PA 1162 CG5712-PA 1..1162 1..1162 6060 100 Plus
ACXD-PB 506 CG5712-PB 1..505 1..505 2627 100 Plus
ACXC-PA 1130 CG5983-PA 8..1094 12..1151 1962 39.6 Plus
ACXE-PB 1123 CG17178-PB 15..1083 32..1154 1957 39.2 Plus
ACXA-PA 1112 CG17176-PA 24..1089 31..1151 1926 39.3 Plus