Clone BO26741 Report

Search the DGRC for BO26741

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptTom70-RA
Protein status:BO26741.pep: Imported from assembly
Sequenced Size:1801

Clone Sequence Records

BO26741.complete Sequence

1801 bp assembled on 2010-09-13

GenBank Submission: KX795745

> BO26741.complete
GAAGTTATCAGTCGACATGGCGATGACTCTGAACATTGGCTCGATGAAGC
TGACAAAGTGGCAGCTGGCGCTCATCCTTGGAACTCCCCTGGCCATTGGA
CTGGGCACCTATGCGGTGAAGAGCTGGACGGCTGCGTCCAAGGAGTTGGA
CGGGGAGAAGAAGAGACCAAAGGCCAAGATCGAGAAGCAGGCCATCTCCC
TGGACGGCACCGCACCGGACCAGGAGCTAGAGCGCAATCAAAAGTCCGCT
GAGCTGGGCGAGAAGCTGTCGCCTCTTAAGGAGGCCAACAACTACAAGAC
GGAGGGTAACAACTGCTACAGGAATGGGAAGTACGATGAGGCCATTAAAT
TCTATGACAAGGCCATCGACAAGTGTCCCAAGGAGCACCGCACTGACATG
GCCATCTTCTACCAGAACCGCGCCGCCTCTTACGAGATGCTCAAGAAGTG
GTCCAACGTCAAGGAGGACTGCACAGCCTCGCTGGAGTTCAATCCTCGTT
ACGCCAAGGCATATTATCGTCGTGCCCGTGCTCACGAAGCCACCAAGGAT
ATGAACGAGTGCTTGGACGATGTCACAGCCACCTGTATCCTGGAGATGTT
CCAAAATAATCAAACTATCATGTTCGCTGACCGTGTGCTCAAGGAGACCG
GCCGACTGGACGCCGAGAAGGGTATGCGCAATCGGGTGCCAGTCGTGCCG
TCGGCTTGCTTCGTAAACACCTACACGCGTTCCTTCATCGCGGATCCGCT
GCAGACCATGAAAGTCCCAGCCCCTAAATCCGATGCACCCCCAAAGGGTT
TCCTGCGCGCCCACCTCGCTTTCCTCGAGGAGAAGTACGAGGAAATTATT
CCCGCCTGCACCGAAGAGATCGAATCCTCCGAGGCCGAAGCACAGTACAA
AGTGGAGGCTCTGCTTATGCGGGGAACTTTCCATCTGCTGTGCGGCTCCT
ATGTAGAAAGCCAGCAGGACTTTGATGCTATTATAGCTAATGACTATGCT
GATCCCAACTTGCGTGCGTATGCCTACATAAAGCGGGCAGCTCTCTACAT
CCAGCTGGATCAGCGCGAAAAGGGTATAGCCGATTTTGCTGAGGCGGAAC
GCCTGAACCCAGAGAACCCAGATGTGTACCACCAGCGCGCCCAGATACTT
CTGCTGCTGGAGCAGATAGAGCCCGCCTTGGCCGAGTTCGAAAAGGCGGT
GAGCATTGCACCCAACCACGCCATCGCCTTCGTCCAGAAGTGCTATGCCG
AGTACCGACTATCCCTCCTGGCCGGCGACCAGCGGCGCTTGGAGAGCGTA
ATGCACACCTTCCAAAATGCCATCGAGCGTTTCCCGAGCTGCGTTGAGTG
CTATAGTCTAACGGCTCAGGTGTTGGCCGACCAGCAACAGTTTACCCAGG
CGGAGGAATACTACAAAAAGGCCATGGTATTGGCGCCAACAAATCCTGCA
CTTATCGTTCACCAGGCCATCATGGTGCTTCAGTGGCGCGGAGACATTAA
TTTGGCTGTCCAGCTGCTCAACAAGGCGATCGAAGTAGATCCCAAATGCG
AGCTGGCCTACGAGACACTCGGAACAGTCGAAGTTCAGCGGGCGCAACTC
ACACGGGCCGTCGAGCTTTTTGAAAAGGCACTGCTTTATGCCAAGAGTCA
GGCGGAGTTGGTGCACGTTTACTCGCTGCGCAACGCGGCAGTGGCCCAAA
TCAACGTCACCAAAAAGCTGGGTATCGACATGAACTCAGTGTCGGCAATG
GCCCAATCCGGATTGATGGCCCAGGGCGTTGCAGCAAGCTTTCTAGACCA
T

BO26741.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:19:44
Subject Length Description Subject Range Query Range Score Percent Strand
Tom70-RC 1770 CG6756-PC 1..1767 17..1783 8835 100 Plus
Tom70-RB 1770 CG6756-PB 1..1767 17..1783 8835 100 Plus
Tom70-RA 1770 CG6756-PA 1..1767 17..1783 8835 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:19:45
Subject Length Description Subject Range Query Range Score Percent Strand
Tom70-RC 2297 CG6756-RC 260..2026 17..1783 8835 100 Plus
Tom70-RB 2237 CG6756-RB 181..1947 17..1783 8835 100 Plus
Tom70-RA 2218 CG6756-RA 181..1947 17..1783 8835 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12037155..12038130 992..17 4880 100 Minus
2L 23513712 2L 12036274..12037065 1783..992 3960 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:19:43 has no hits.

BO26741.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:28 Download gff for BO26741.complete
Subject Subject Range Query Range Percent Splice Strand
Tom70-RC 84..1850 17..1785 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:44 Download gff for BO26741.complete
Subject Subject Range Query Range Percent Splice Strand
Tom70-RA 181..1947 17..1785 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:15:31 Download gff for BO26741.complete
Subject Subject Range Query Range Percent Splice Strand
Tom70-RA 181..1947 17..1785 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:15:31 Download gff for BO26741.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12037155..12038130 17..992 100   Minus
2L 12036272..12037064 993..1785 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:44 Download gff for BO26741.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12037155..12038130 17..992 100   Minus
arm_2L 12036272..12037064 993..1785 99 <- Minus

BO26741.pep Sequence

Translation from 16 to 1801

> BO26741.pep
MAMTLNIGSMKLTKWQLALILGTPLAIGLGTYAVKSWTAASKELDGEKKR
PKAKIEKQAISLDGTAPDQELERNQKSAELGEKLSPLKEANNYKTEGNNC
YRNGKYDEAIKFYDKAIDKCPKEHRTDMAIFYQNRAASYEMLKKWSNVKE
DCTASLEFNPRYAKAYYRRARAHEATKDMNECLDDVTATCILEMFQNNQT
IMFADRVLKETGRLDAEKGMRNRVPVVPSACFVNTYTRSFIADPLQTMKV
PAPKSDAPPKGFLRAHLAFLEEKYEEIIPACTEEIESSEAEAQYKVEALL
MRGTFHLLCGSYVESQQDFDAIIANDYADPNLRAYAYIKRAALYIQLDQR
EKGIADFAEAERLNPENPDVYHQRAQILLLLEQIEPALAEFEKAVSIAPN
HAIAFVQKCYAEYRLSLLAGDQRRLESVMHTFQNAIERFPSCVECYSLTA
QVLADQQQFTQAEEYYKKAMVLAPTNPALIVHQAIMVLQWRGDINLAVQL
LNKAIEVDPKCELAYETLGTVEVQRAQLTRAVELFEKALLYAKSQAELVH
VYSLRNAAVAQINVTKKLGIDMNSVSAMAQSGLMAQGVAASFLDH

BO26741.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Tom70-PC 589 CG6756-PC 1..589 1..589 3015 100 Plus
Tom70-PB 589 CG6756-PB 1..589 1..589 3015 100 Plus
Tom70-PA 589 CG6756-PA 1..589 1..589 3015 100 Plus
unc-45-PA 947 CG2708-PA 10..109 87..188 211 42.2 Plus
CG14894-PB 263 CG14894-PB 65..189 61..185 173 29.6 Plus