Clone BO26756 Report

Search the DGRC for BO26756

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG33696-RA
Protein status:BO26756.pep: Imported from assembly
Sequenced Size:1474

Clone Sequence Records

BO26756.complete Sequence

1474 bp assembled on 2010-09-13

GenBank Submission: KX795120

> BO26756.complete
GAAGTTATCAGTCGACATGGATATGGAGTATATAACTAGCAGTAGTGGCA
ACATAACTGCCACTACAGAAGCAGATTTCAGTTCATCTTTGGGCGAATCC
AATGTCACGGAATACAATACAACGGAAATGGACGCGAATGAATCAGCTGG
CGAGGATGAGGAGATGCTAAGGATAGCCTTTTTTATAGGGCACTTCGTGC
ATCAATACTATATACCAGTGCTTTGCTGCACGGGCAGCATTGGCAATATC
CTCTCCGTGTTTGTCTTCTTTAGGACCAAGTTGAGAAAGTTGTCCTCCAG
CTTTTACCTGGCCGCTCTCGCAGTGAGCGACACCTGCTTCCTGGCCGGAC
TCTTCGCACAGTGGCTGAACTTCCTCAATGTGGATATCTATAATCAAAAC
TACTTTTGCCAGTTCTTCACGTTCTTCAGCTACCTGGCCAGCTTCTGCTC
CGTCTGGTTTGTGGTGGCCTTCACCGTGGAGCGCTTCATTGCCGTCATCT
ATCCACTGAAGCGCCAGACCATGTGCACCGTGCGCCGGGCCAAGATCGTC
CTGTTTTGTTTGACACTCGTGGGATGTCTGCACTGTCTGCCCTATATAGT
CATTGCCAAGCCGGTGTTTATGCCCAAATTGAACACGACCATTTGCGATC
TCAACTCGGAATACAAAGAACAACTGGCCCTCTTCAACTACTGGGACACC
ATAGTTGTCTATGCGGTGCCCTTCACCACCATCGCCGTTCTGAACACCTG
TACAGGTTGTACGGTGTGGAAGTTCGCCACCGTTCGCCGAACGCTGACCA
TGCACAAGATGAAGCCCCAAACGAACAGCATGCCATCGAACTCGTCGAAC
TCATCGGGCGGAGCCTCATCTGCAGTGGCCTCGTACCGCCTATCGGCATC
GCTGAAGCGCCAGAAGTCGACGGGAACGCATCCAAGTGGACAGCATAATG
TGGCCAACAGGCAGACGGATGATCAGGAGCAGCAACAGCAGTCGCAGCAG
CATCAAATAAACAATTGCCAACACCATTGCGAGATTACGCAGAAACCAGC
CCGTCGCAAGGTGCAAAACTCATCGCAGCTCAAGGTAACCAAAATGCTGC
TAATTGTCTCGACGGTTTTTGTTTGCCTCAATTTGCCCAGCTGCCTGCTG
CGCATCGAGGCCTATTGGGAGACGGAGTCGGCCCGAAACCAGAATTCCAC
AATTGCTTTGCAATATATTTTTCACGCTTTCTTCATCACCAATTTTGGCA
TCAATTTCGTGCTTTACTGCGTCAGTGGACAGAATTTCCGCAAAGCCGTT
TTGAGTATTTTCCGAAGGGTTTCATCCGCTCAACGGGAGGCGGGAAACAC
CCAAGTGACAGTTTCTGAATACTGTCGCAATACTGGCACATCCACACGTC
GTCGAATGATGACGCAACATTGTTGGAACGAAATGCACGAGTTGCATCCA
CTCAAGGCAAGCTTTCTAGACCAT

BO26756.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
CNMaR-RA 1443 CG33696-PA 1..1440 17..1456 7200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
CNMaR-RA 2704 CG33696-RA 727..2167 16..1456 7205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9644835..9645487 16..668 3265 100 Plus
3L 28110227 3L 9650980..9651218 811..1049 1195 100 Plus
3L 28110227 3L 9650344..9650487 668..811 720 100 Plus
3L 28110227 3L 9651604..9651727 1048..1171 620 100 Plus
3L 28110227 3L 9653483..9653603 1170..1290 605 100 Plus
3L 28110227 3L 9658799..9658896 1359..1456 490 100 Plus
3L 28110227 3L 9653722..9653793 1290..1361 360 100 Plus
Blast to na_te.dros performed 2014-11-28 08:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1089..1140 972..1026 132 76.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6784..6849 961..1026 123 65.2 Plus
roo 9092 roo DM_ROO 9092bp 1090..1135 961..1006 122 73.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2332..2386 972..1026 122 69.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2337..2410 955..1026 121 68 Plus

BO26756.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:27 Download gff for BO26756.complete
Subject Subject Range Query Range Percent Splice Strand
CG33696-RA 728..2167 17..1458 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:40 Download gff for BO26756.complete
Subject Subject Range Query Range Percent Splice Strand
CG33696-RA 728..2167 17..1458 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:15:15 Download gff for BO26756.complete
Subject Subject Range Query Range Percent Splice Strand
CNMaR-RA 728..2167 17..1458 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:15:15 Download gff for BO26756.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9658802..9658896 1362..1458 97   Plus
3L 9653723..9653793 1291..1361 100 -> Plus
3L 9653485..9653603 1172..1290 100 -> Plus
3L 9651606..9651727 1050..1171 100 -> Plus
3L 9650980..9651218 811..1049 100 -> Plus
3L 9650344..9650486 668..810 100 -> Plus
3L 9644836..9645486 17..667 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:40 Download gff for BO26756.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9651902..9651996 1362..1458 97   Plus
arm_3L 9646823..9646893 1291..1361 100 -> Plus
arm_3L 9646585..9646703 1172..1290 100 -> Plus
arm_3L 9644706..9644827 1050..1171 100 -> Plus
arm_3L 9644080..9644318 811..1049 100 -> Plus
arm_3L 9643444..9643586 668..810 100 -> Plus
arm_3L 9637936..9638586 17..667 100 -> Plus

BO26756.pep Sequence

Translation from 16 to 1474

> BO26756.pep
MDMEYITSSSGNITATTEADFSSSLGESNVTEYNTTEMDANESAGEDEEM
LRIAFFIGHFVHQYYIPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAA
LAVSDTCFLAGLFAQWLNFLNVDIYNQNYFCQFFTFFSYLASFCSVWFVV
AFTVERFIAVIYPLKRQTMCTVRRAKIVLFCLTLVGCLHCLPYIVIAKPV
FMPKLNTTICDLNSEYKEQLALFNYWDTIVVYAVPFTTIAVLNTCTGCTV
WKFATVRRTLTMHKMKPQTNSMPSNSSNSSGGASSAVASYRLSASLKRQK
STGTHPSGQHNVANRQTDDQEQQQQSQQHQINNCQHHCEITQKPARRKVQ
NSSQLKVTKMLLIVSTVFVCLNLPSCLLRIEAYWETESARNQNSTIALQY
IFHAFFITNFGINFVLYCVSGQNFRKAVLSIFRRVSSAQREAGNTQVTVS
EYCRNTGTSTRRRMMTQHCWNEMHELHPLKASFLDH

BO26756.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
CNMaR-PA 480 CG33696-PA 1..480 1..480 2525 100 Plus
Proc-R-PE 545 CG6986-PE 4..170 23..182 214 32.6 Plus
Proc-R-PD 545 CG6986-PD 4..170 23..182 214 32.6 Plus
Proc-R-PC 545 CG6986-PC 4..170 23..182 214 32.6 Plus
Proc-R-PB 545 CG6986-PB 4..170 23..182 214 32.6 Plus