Clone BO26759 Report

Search the DGRC for BO26759

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:59
Vector:pDNR-Dual
Associated Gene/TranscriptIrk2-RB
Protein status:BO26759.pep: Imported from assembly
Sequenced Size:1345

Clone Sequence Records

BO26759.complete Sequence

1345 bp assembled on 2010-09-13

GenBank Submission: KX797722

> BO26759.complete
GAAGTTATCAGTCGACATGCAGGTCCCGCTCAGCGATGTTCAGGTCCTGC
AGGATCCCACCGACGCGGAAACCCTTGTCGGCGGCGACAAGGAGGAGACC
TTTGCCCACATGAAGGAGTGGAAGCGCCAGTACATGCGGGGCATCTCGCA
CACGCCATCGCAGGCGGGAGTCTACTACGAGGCCTTGAAGGGTTCCAGCC
ACTCGCTGGCCAAAGGATCTCGCAATTTCCGGCCTGGCAGCATGAGACGT
GTTCGCCGACGAGCGGTCTTCAAAAATGGTGACTGCAATGTGGTGCAGAA
GCACCTGCAAAGACGCCGAGTTCGTTTCCTGCAGGACATGTACACCACCA
TGGTGGATTGGCAGTGGCGGTGGACTCTCTTGGCCTTCGCACTCAGCTTT
ATCCTGTCTTGGCTCTTCTTTGCTCTCATCTGGTGGCTGATTATCTACAC
ACACGGAGACTTGGAAGAGCCTCACTTGCCAGAAAACCAAGAGGAATCTG
GTTGGGCGCCTTGTGTTTCGGCCATCGATGGCTTTACTTCCTGCTTCCTG
TTCTCCATTGAAACGCAGCACACTATTGGCTACGGTGTCCGAACCACCTC
GCCCGAGTGTCCAGAGGCCATCTTCATGATGTGCTTCCAGTCCATCTATG
GCGTGATGTCTTCAGCATTTATGGCCGGAATAGTGTTTGCCAAGATGACA
AGGGCCAAACAGCGGGCACAGACTTTGTTGTTCTCCAAACACGCCGTAAT
TTGCCAACGTGATGGCACCCTTTCGCTGATGTTCCGTGTGGGTGACATGC
GAAAATCACACATCATTGGAGCCGGAGTGAGGGCTCAGTTGATCAGGACA
AAGAGCACCAAGGAGGGTGAGGTGATGACACAGTACTTCACAGAACTGGA
GATCGGTACTGATGACTCCGGCTCTGATTTGTTCTTCATCTGGCCCATGG
TCATCGAGCACAAGATCGACGAGAACTCACCGCTCTATAATCTTAATGCC
ACTGATATGCTGCAGGATAAGTTCGAAATCGTGGTGATCCTAGAGGGCAC
CGTGGAGTCCACTGGACAGAGCACTCAAGCCAGATCCAGCTATATTAACA
CTGAGATCCTTTGGGGACATCGTTTCGATCCAGTGGTGTTGTACAACAAG
GATCTGCAGGCCTATGAAATCGACTACGCTCGCTTTAACGAAACCACTCA
GGTGGACACTCCGTTGTGCAGTGCTCGGGAATTGAACGAGATCTACAAGA
TCCAGGAGGGATTCCGCACACCAGAAACCACCTTTACCATGCGTCAACTG
TCCCACAATCATTCTGACCAGGCCTCCGCAAGCTTTCTAGACCAT

BO26759.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Irk2-RB 1314 CG4370-PB 1..1311 17..1327 6555 100 Plus
Irk2-RC 1356 CG4370-PC 1..1258 17..1274 6290 100 Plus
Irk2-RA 1362 CG4370-PA 248..1359 216..1327 5560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
Irk2-RB 1600 CG4370-RB 50..1360 17..1327 6555 100 Plus
Irk2-RC 1485 CG4370-RC 50..1307 17..1274 6290 100 Plus
Irk2-RA 1894 CG4370-RA 543..1654 216..1327 5560 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23514377..23515161 1274..490 3925 100 Minus
3R 32079331 3R 23515213..23515488 491..216 1380 100 Minus
3R 32079331 3R 23518070..23518269 216..17 1000 100 Minus
3R 32079331 3R 23514271..23514326 1327..1272 280 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:21:23 has no hits.

BO26759.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:30 Download gff for BO26759.complete
Subject Subject Range Query Range Percent Splice Strand
Irk2-RB 45..1355 17..1329 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:50 Download gff for BO26759.complete
Subject Subject Range Query Range Percent Splice Strand
Irk2-RB 50..1360 17..1329 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:16:12 Download gff for BO26759.complete
Subject Subject Range Query Range Percent Splice Strand
Irk2-RB 50..1360 17..1329 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:16:12 Download gff for BO26759.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23518070..23518269 17..216 100   Minus
3R 23515213..23515487 217..491 100 <- Minus
3R 23514377..23515159 492..1274 100 <- Minus
3R 23514269..23514323 1275..1329 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:50 Download gff for BO26759.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19343792..19343991 17..216 100   Minus
arm_3R 19340935..19341209 217..491 100 <- Minus
arm_3R 19340099..19340881 492..1274 100 <- Minus
arm_3R 19339991..19340045 1275..1329 96 <- Minus

BO26759.pep Sequence

Translation from 16 to 1345

> BO26759.pep
MQVPLSDVQVLQDPTDAETLVGGDKEETFAHMKEWKRQYMRGISHTPSQA
GVYYEALKGSSHSLAKGSRNFRPGSMRRVRRRAVFKNGDCNVVQKHLQRR
RVRFLQDMYTTMVDWQWRWTLLAFALSFILSWLFFALIWWLIIYTHGDLE
EPHLPENQEESGWAPCVSAIDGFTSCFLFSIETQHTIGYGVRTTSPECPE
AIFMMCFQSIYGVMSSAFMAGIVFAKMTRAKQRAQTLLFSKHAVICQRDG
TLSLMFRVGDMRKSHIIGAGVRAQLIRTKSTKEGEVMTQYFTELEIGTDD
SGSDLFFIWPMVIEHKIDENSPLYNLNATDMLQDKFEIVVILEGTVESTG
QSTQARSSYINTEILWGHRFDPVVLYNKDLQAYEIDYARFNETTQVDTPL
CSARELNEIYKIQEGFRTPETTFTMRQLSHNHSDQASASFLDH

BO26759.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
Irk2-PB 437 CG4370-PB 1..437 1..437 2308 100 Plus
Irk2-PC 451 CG4370-PC 1..429 1..429 2219 98.1 Plus
Irk2-PA 453 CG4370-PA 84..453 68..437 1957 100 Plus
Irk2-PD 454 CG4370-PD 84..454 68..437 1945 99.7 Plus
Irk1-PB 555 CG44159-PB 14..413 52..443 1076 54.5 Plus