Clone BO26769 Report

Search the DGRC for BO26769

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptCG17109-RA
Protein status:BO26769.pep: Imported from assembly
Sequenced Size:1234

Clone Sequence Records

BO26769.complete Sequence

1234 bp assembled on 2010-08-18

GenBank Submission: KX794569

> BO26769.complete
GAAGTTATCAGTCGACATGAGTACCGAAAAGTGGGAGGACAACGAGGAAA
TCAAAATATTCCGCGAATATTTGCGCATAGCTACGGTGCAGCCAAATGTG
GATTACACCGAATGTGTGGAGTTCCTGAAAAGGCAGGCTCACAGCCTGGA
TCTTCCCGTGGATGTTATATATCCAGTGGAGAAGAAGCCTGTGGTGATCA
TCAAGTGGTTGGGCACCGAACCGGAGCTGCCCTCCGTCATTCTCAACTCG
CACATGGATGTGGTGCCGGTGTTCCGTGACAAGTGGACCCACGATCCCTT
CGCTGCCGATATCGATGAGGAGGGCAGGATCTTTGCGCGCGGTACTCAGG
ACATGAAGTCGGTGGGCACAGGATATCTGGGTGCCATCCGCCTGCTTAAG
GCAAGTGGTGTCCAGCCCAAGCGCAATTTCTTCGTGACCTTTGTGCCCGA
TGAGGAGATCGGCGGCGAGCTGGGCATGCAGGAGTTCGTCAAAACGGAAT
ACTACAGCAACATGAATGTTGGTTTCAGTCTGGACGAGGGCGGCACCAGT
GAAATAGATCTGTTCTATGTCTTTTATGCCGAACGTATGCGATGGGGTCT
CAAGCTGAATTTCAGTGGAACCTCTGGACACGGCTCCATGTTGCTGCCCA
GCACTGCCGGCGTGAAACTGAACTATGTGCTCAACAAGCTGACGGAGTTC
CGCGAATCGCAGGTTCAGAGGCTGGCCAATGATCAGACAATCAACATCGG
TGATGTGACAACTATCAATCTCACCCAGCTGAGCGGTGGAGTCCAGAGCA
ATGTGGTGCCTCCTCATTTCGAGGCTGTCTTCGACATGCGTCTGTCCATC
ACCCTGGATGTGGTTGCCTTTGAGAAACAGATCCACGATTGGTGCGAGGA
GGCAGGTGGCGGCATCGAGATCTCCTTCGACGAGAAGGAACCCTACGTGG
CACCCACAAAGATCGACGACTCCAATCCATTCTGGCTGGCTTTCAAGGCT
GCCACCGATGAACTTGGCCTTAAGATCTACCCCATTGTCTGCCCCGGTGC
CACCGACAGCAGGAACATTCGAGCTCAGGGCATTCCAGCCTTGGGATTCT
CACCCATCAAAAATACCACCATGCGCATCCATGATCACGATGAGTTCTTG
GGCGCCGAAACTTATTTGAAGGGCATTCAAATATACAAGAAAATTTTGGG
CAACCTAGCGAATGTCGCAAGCTTTCTAGACCAT

BO26769.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG17109-RB 1203 CG17109-PB 1..1200 17..1216 5985 99.9 Plus
CG17109-RA 1203 CG17109-PA 1..1200 17..1216 5985 99.9 Plus
CG6733-RA 1206 CG6733-PA 10..1133 26..1146 1565 76.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG17109-RB 1373 CG17109-RB 44..1243 17..1216 5985 99.9 Plus
CG17109-RA 1313 CG17109-RA 44..1243 17..1216 5985 99.9 Plus
CG6733-RA 1291 CG6733-RA 26..1164 11..1146 1580 76.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23095883..23096373 108..598 2455 100 Plus
3R 32079331 3R 23096431..23096849 596..1014 2095 100 Plus
3R 32079331 3R 23096909..23097110 1015..1216 1010 100 Plus
3R 32079331 3R 23097912..23098400 113..598 640 75.9 Plus
3R 32079331 3R 23098460..23098872 599..1011 625 76.8 Plus
3R 32079331 3R 23100283..23100589 616..922 455 76.5 Plus
3R 32079331 3R 23095733..23095823 17..107 440 98.9 Plus
3R 32079331 3R 23099802..23100165 188..551 425 74.5 Plus
3R 32079331 3R 23092066..23092491 118..540 385 73.2 Plus
3R 32079331 3R 23092616..23092919 612..915 365 74.7 Plus
3R 32079331 3R 23091871..23091961 17..107 245 84.6 Plus
3R 32079331 3R 23093909..23094091 184..366 240 75.4 Plus
3R 32079331 3R 23097753..23097841 11..99 190 80.9 Plus
3R 32079331 3R 23099003..23099064 1085..1146 190 87.1 Plus
Blast to na_te.dros performed on 2014-11-28 08:57:05 has no hits.

BO26769.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:53:10 Download gff for BO26769.complete
Subject Subject Range Query Range Percent Splice Strand
CG17109-RA 41..1240 17..1218 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:28 Download gff for BO26769.complete
Subject Subject Range Query Range Percent Splice Strand
CG17109-RA 44..1243 17..1218 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:03 Download gff for BO26769.complete
Subject Subject Range Query Range Percent Splice Strand
CG17109-RA 44..1243 17..1218 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:03 Download gff for BO26769.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23096909..23097110 1015..1218 99   Plus
3R 23096432..23096849 597..1014 100 -> Plus
3R 23095883..23096371 108..596 100 -> Plus
3R 23095733..23095823 17..107 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:28 Download gff for BO26769.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18922631..18922832 1015..1218 99   Plus
arm_3R 18922154..18922571 597..1014 100 -> Plus
arm_3R 18921605..18922093 108..596 100 -> Plus
arm_3R 18921455..18921545 17..107 98 -> Plus

BO26769.pep Sequence

Translation from 16 to 1234

> BO26769.pep
MSTEKWEDNEEIKIFREYLRIATVQPNVDYTECVEFLKRQAHSLDLPVDV
IYPVEKKPVVIIKWLGTEPELPSVILNSHMDVVPVFRDKWTHDPFAADID
EEGRIFARGTQDMKSVGTGYLGAIRLLKASGVQPKRNFFVTFVPDEEIGG
ELGMQEFVKTEYYSNMNVGFSLDEGGTSEIDLFYVFYAERMRWGLKLNFS
GTSGHGSMLLPSTAGVKLNYVLNKLTEFRESQVQRLANDQTINIGDVTTI
NLTQLSGGVQSNVVPPHFEAVFDMRLSITLDVVAFEKQIHDWCEEAGGGI
EISFDEKEPYVAPTKIDDSNPFWLAFKAATDELGLKIYPIVCPGATDSRN
IRAQGIPALGFSPIKNTTMRIHDHDEFLGAETYLKGIQIYKKILGNLANV
ASFLDH

BO26769.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG17109-PB 400 CG17109-PB 1..400 1..400 2097 100 Plus
CG17109-PA 400 CG17109-PA 1..400 1..400 2097 100 Plus
CG6733-PA 401 CG6733-PA 1..401 1..400 1663 77.1 Plus
CG6738-PA 401 CG6738-PA 1..401 1..400 1565 72.8 Plus
CG6726-PC 401 CG6726-PC 1..400 1..399 1481 68.2 Plus