Clone BO26784 Report

Search the DGRC for BO26784

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptRpS11-RC
Protein status:BO26784.pep: Imported from assembly
Sequenced Size:499

Clone Sequence Records

BO26784.complete Sequence

499 bp assembled on 2010-08-18

GenBank Submission: KX796104

> BO26784.complete
GAAGTTATCAGTCGACATGGCTGATCAGAACGAGCGCGCCTTCCAAAAAC
AATTCGGTGTCAACCTAAACCGCAAGGTCAAGCCCGGTATCACCAAGAAG
AAGCTGCTGCGTCGCTCCCGCGATGTGGGACTCGGTTTCAAGACCCCACG
TGAGGCCATCGATGGTACCTACATCGACAAGAAGTGCCCCTGGACCGGTG
ATGTGAGGATCCGTGGTCGCATTCTGACCGGCGTGGTCCGCAAGGCCAAG
ATGCAGCGCACCATTGTCATTCGGCGCGACTACCTGCACTTTGTGCGCAA
ATACAGCCGTTTCGAGAAGCGTCACCGCAACATGAGCGTCCACTGCTCCC
CTGTGTTCAGAGATGTTGAGCATGGCGATATTGTCACCATTGGTGAGTGC
CGTCCTCTGTCCAAGACTGTGCGCTTCAACGTCCTGAAAGTCAGCAAGGG
TCAGGGAGCCAAGAAGAGCTTCAAGAAGTACGCAAGCTTTCTAGACCAT

BO26784.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-RC 468 CG8857-PC 1..465 17..481 2325 100 Plus
RpS11-RB 465 CG8857-PB 133..462 152..481 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-RC 738 CG8857-RC 28..494 15..481 2335 100 Plus
RpS11-RB 569 CG8857-RB 162..491 152..481 1650 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12199834..12200041 360..153 1040 100 Minus
2R 25286936 2R 12200115..12200244 155..26 650 100 Minus
2R 25286936 2R 12199469..12199592 481..358 620 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:57:34 has no hits.

BO26784.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:53:17 Download gff for BO26784.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RA 43..507 17..483 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:37 Download gff for BO26784.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RC 30..494 17..483 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:09 Download gff for BO26784.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RC 30..494 17..483 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:09 Download gff for BO26784.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12200116..12200249 21..154 98   Minus
2R 12199834..12200039 155..360 100 <- Minus
2R 12199467..12199589 361..483 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:37 Download gff for BO26784.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8087621..8087754 21..154 98   Minus
arm_2R 8087339..8087544 155..360 100 <- Minus
arm_2R 8086972..8087094 361..483 98 <- Minus

BO26784.pep Sequence

Translation from 16 to 499

> BO26784.pep
MADQNERAFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTPREAIDG
TYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFE
KRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKVSKGQGAKK
SFKKYASFLDH

BO26784.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-PC 155 CG8857-PC 1..155 1..155 812 100 Plus
RpS11-PB 154 CG8857-PB 1..154 1..155 660 83.3 Plus