Clone BO26802 Report

Search the DGRC for BO26802

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG9330-RA
Protein status:BO26802.pep: Imported from assembly
Sequenced Size:2158

Clone Sequence Records

BO26802.complete Sequence

2158 bp assembled on 2010-09-13

GenBank Submission: KX799285

> BO26802.complete
GAAGTTATCAGTCGACATGAGCGAGTACACAAGCATTCTGCAGCGCGAGT
TTCCCAAAATCGACCACGAGCTGCTCACCTATGTCGTTGGCGTGCTCACC
GGAAGCGAGGAGGACTTCGAAAGCGGCGATGACATCTTCGAAGCGGTGGG
CGACATCCTGCAGAGCGTCGACTGTGATAGGTCGGAGGAGAGTGTACGTA
CGCTTTGCGAGCAGTTCCTCAACATCATGAAGAACAACGAGGTCAACGTG
GAGCGAAAGGTTCTCAACGCGCCGGTCAACATCGAGGAGATGGCCAAGAA
CATGGAGCGGCTGGACAAGGATATGCAAAGCATCTGGGTGGCCAACAAAG
ATGGCGCCAATAAAGTGGACTCCAAGAAACTAGGAAAGGCGGAGGCCAAG
CTGCAGCAGAAGCAGGAGAAACGGCAGGAGGTGAACAAACATGGTATGAT
TCCTGTTGCGGTGAAGCTACAAACGGCCACAGCCTCACAGGTGACCAACA
AGAAGAACACCAAGCTGGATCAGAAAGGTCTTAACCGATCCATGGACATC
AAGATCGAAAACTTTGACCTGGCTTTTGGCGAAAAAGTTCTTCTGCAGAA
TGCGAATCTGCTGCTGTCTTACGGACGCCGCTATGGTCTGGTGGGACGCA
ATGGCCTGGGCAAGACTACACTGCTCCGCATGATTGCCGAGCGACAGCTA
CAGATCCCTTCGCACATATCGGTGCTGCACGTGGAGCAGGAGGTGGTTGG
CGATGACACACCAGCAGTGGAGAGTGTGCTGGAATGTGATACTGAGCGAA
CGAGACTTCTGACCCGCGAGAAGGAGATTCTGGCTGCCCTTAACAATGGA
GTTCAGGATGCGACGCTGTCCAATGAGCTGAGCGAGACCTACGCCTCTCT
GCAGAACATCGAGGCGGACAAGGCTGTGGCCCGCGCATCTGTGATACTTA
AGGGCTTGGGATTCGATGCAGATATGCAGCTGCGTCCAACTAAATCCTTC
TCAGGCGGCTGGCGCATGCGTCTTGCTTTGGCCAGGGCACTGTTCTCAAA
ACCCGATCTGTTACTGCTCGATGAGCCGACGAACATGTTAGACATCAAAG
CCATTATTTGGCTGGAAAACTATCTGCAGACATGGGCCACCACCATTCTG
GTAGTTTCTCACGATCGCAACTTCCTGGACACGGTGCCGACAGACATTAT
TCACCTACATTCCCAGGAACTGGAGGCATACAAGGGAAACTATGAACAGT
TCGAGAAGACCAAGACGGAGAAGCTGAAGTCCCAAAGACGTGAATACGAG
GCCCAAATGGCTCACAGAGCTCATGTCCAAGACTTCATCGATCGCTTCCG
ATACAACGCAAACCGTGCCTCGTCTGTGCAATCCAAAATTAAAATGCTCG
AAAAGCTGCCGGAACTAAAGCCAGTGGAAAAGGAGACTGTGGTCACGCTC
AAATTCCCCGAAGTGGAACCCCTTAATCCTCCCGTGCTGGCCATTTCGGA
GGTTACTTTCCGTTACAATCCAGAAGATCCACTGCCCATCTTCAAGGGCG
TCAATCTCTCAGCCACATCGGACTCTCGAATTTGCATTGTCGGAGAAAAC
GGAGCGGGAAAGTCGACGCTGCTGAAGATTATTGTCGGTCAACTGAGCAC
TATTCACGGAAACATTGTCCTGCATCGCGGTCTTCGAATTGGATATTTTG
CGCAGCACCATGTGGACCATCTGAATATGAATGTAACGTGTGTGGGAGTT
TTGGCAGAACTGTTTCCTGGTCGCCCGGACGAAGAGTATCGCCGGCAGTT
GGGCAGCTTCGGCATATCCGGACCACTGGCACTGCAGAGCATTGCCAGTT
TATCTGGAGGACAAAAATCACGAGTGGCCTTAGCAAAGATGTGCATGGCG
GAGCCAAATTTCCTGGTGCTCGATGAGCCGACTAATCACTTGGACATTGA
AACCATTGATGCTTTGGGCCGAGCCATAAATGCCTTTAAGGGCGGCGTAA
TCCTGGTTTCCCACGACGAACGCCTCATTAAGGTCGTCTGCAAGGAACTC
TGGGTGTGTGGCAATCGCACAGTCAGAGCGATCGAAGGTGGTCTGGACGA
GTATAAGCGCGAGGTTTACAAGGAAATCGAAGCTAATAGTGCAAGCTTTC
TAGACCAT

BO26802.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG9330-RA 2127 CG9330-PA 1..2124 17..2140 10605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG9330-RA 2384 CG9330-RA 130..2253 17..2140 10605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19587174..19587822 586..1234 3245 100 Plus
3L 28110227 3L 19588123..19588613 1408..1898 2455 100 Plus
3L 28110227 3L 19586535..19586791 105..361 1285 100 Plus
3L 28110227 3L 19586892..19587115 362..585 1120 100 Plus
3L 28110227 3L 19587881..19588055 1234..1408 860 99.4 Plus
3L 28110227 3L 19588829..19588980 1989..2140 760 100 Plus
3L 28110227 3L 19588679..19588772 1898..1991 470 100 Plus
3L 28110227 3L 19586382..19586470 17..105 445 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:18:01 has no hits.

BO26802.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:26 Download gff for BO26802.complete
Subject Subject Range Query Range Percent Splice Strand
CG9330-RA 128..2251 17..2142 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:34 Download gff for BO26802.complete
Subject Subject Range Query Range Percent Splice Strand
CG9330-RA 130..2253 17..2142 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:14:57 Download gff for BO26802.complete
Subject Subject Range Query Range Percent Splice Strand
CG9330-RA 130..2253 17..2142 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:14:57 Download gff for BO26802.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19588831..19588980 1991..2142 98   Plus
3L 19588680..19588771 1899..1990 100 -> Plus
3L 19588123..19588613 1408..1898 100 -> Plus
3L 19587881..19588054 1234..1407 99 -> Plus
3L 19587174..19587821 586..1233 100 -> Plus
3L 19586892..19587115 362..585 100 -> Plus
3L 19586535..19586791 105..361 100 -> Plus
3L 19586382..19586469 17..104 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:34 Download gff for BO26802.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19581931..19582080 1991..2142 98   Plus
arm_3L 19581780..19581871 1899..1990 100 -> Plus
arm_3L 19581223..19581713 1408..1898 100 -> Plus
arm_3L 19580981..19581154 1234..1407 99 -> Plus
arm_3L 19580274..19580921 586..1233 100 -> Plus
arm_3L 19579992..19580215 362..585 100 -> Plus
arm_3L 19579635..19579891 105..361 100 -> Plus
arm_3L 19579482..19579569 17..104 100 -> Plus

BO26802.pep Sequence

Translation from 16 to 2158

> BO26802.pep
MSEYTSILQREFPKIDHELLTYVVGVLTGSEEDFESGDDIFEAVGDILQS
VDCDRSEESVRTLCEQFLNIMKNNEVNVERKVLNAPVNIEEMAKNMERLD
KDMQSIWVANKDGANKVDSKKLGKAEAKLQQKQEKRQEVNKHGMIPVAVK
LQTATASQVTNKKNTKLDQKGLNRSMDIKIENFDLAFGEKVLLQNANLLL
SYGRRYGLVGRNGLGKTTLLRMIAERQLQIPSHISVLHVEQEVVGDDTPA
VESVLECDTERTRLLTREKEILAALNNGVQDATLSNELSETYASLQNIEA
DKAVARASVILKGLGFDADMQLRPTKSFSGGWRMRLALARALFSKPDLLL
LDEPTNMLDIKAIIWLENYLQTWATTILVVSHDRNFLDTVPTDIIHLHSQ
ELEAYKGNYEQFEKTKTEKLKSQRREYEAQMAHRAHVQDFIDRFRYNANR
ASSVQSKIKMLEKLPELKPVEKETVVTLKFPEVEPLNPPVLAISEVTFRY
NPEDPLPIFKGVNLSATSDSRICIVGENGAGKSTLLKIIVGQLSTIHGNI
VLHRGLRIGYFAQHHVDHLNMNVTCVGVLAELFPGRPDEEYRRQLGSFGI
SGPLALQSIASLSGGQKSRVALAKMCMAEPNFLVLDEPTNHLDIETIDAL
GRAINAFKGGVILVSHDERLIKVVCKELWVCGNRTVRAIEGGLDEYKREV
YKEIEANSASFLDH

BO26802.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG9330-PA 708 CG9330-PA 1..708 1..708 3597 100 Plus
CG1703-PB 901 CG1703-PB 274..880 97..700 1166 42.9 Plus
CG1703-PA 901 CG1703-PA 274..880 97..700 1166 42.9 Plus
CG9281-PD 611 CG9281-PD 5..603 127..708 1055 39.3 Plus
CG9281-PC 611 CG9281-PC 5..603 127..708 1055 39.3 Plus