Clone BO26804 Report

Search the DGRC for BO26804

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG9993-RA
Protein status:BO26804.pep: Imported from assembly
Sequenced Size:1663

Clone Sequence Records

BO26804.complete Sequence

1663 bp assembled on 2010-08-18

GenBank Submission: KX794973

> BO26804.complete
GAAGTTATCAGTCGACATGGCGTCCACCAAGTACGACAGCTTTGAGAAGA
TATGGTCTGGGCCAAAGGACAAGGAGTACTACGGTCCGGATATGACGCTG
GGCGAGGTGGCACTGATCATCCTGCGTCTGTACTCGGACAAGGTGATGCA
GGTGTATGATCCCACGGGCGAGGAGCTCACCGGTAGTCAGTTGCTGGAGC
AAAGTCGTCGATTGGCCCACGCCTTTCAACGATTGAAGCTGCAACGCGGC
GATGTGGTTGGCATTTCGGCCAAGAACACCACCTATCTCACCGAAGTGGT
CATCGCAGCCCTGCTGAATGGCACACCCATCAACCCACTGCATCCGGACT
TCGATGCGGAAACCACGGCCTATATGTTCGAGATCACGAAGCCCAAGGTG
ATATTCTGCGACCTGGACAACTACCAGACCTTGAGCGCGGTCAAAAGCAG
TCTCAAGTTCAAGACGGAGATCATTCTGCTCACTGGAACTCTGCCTGGAG
TGCGTAACATTCAGGATTTGCTTGCAGATGGCTGCACTGGATACGATGAG
AAAACACTCTTTGCCTGCCCGCATTTGTGTGGCGATGATACGGCCTTCAT
CATCACCTCCTCGGGTGTAACCGGTTTGCCAAAGGGCGTAACCCGTTCGC
ATCGCAGTCTGCTGAACAGTGCCAAAATCCCTCAGCTCTTTACCTCGGAT
ACAGTGCTGTTCTGCTTCAGTCCGCTCTATTGGATCAGCTGTATCTTCAC
ACTGCTCGCTTCGCTGGTCAATGGATGTCGCAGGATCATCACCAATCGTC
CTTTCAGCGTGGCGTACTTTGCAGACCTTGTGGAACGACACCAGGTCAGC
TTTGTGCTCACAGTGCCCCACCACATGGCTCTGCTGGCCAAGAGCCCAGA
GAGACAGGAGCTAGCAGCCAAGATGCAGTGTGTTCAGTCCTTCGTGTGCA
GTGGCTCGAAGGTACCGATGGGGATCTGGCGGCAGTTGTACGAGCTACTG
GGTGCGAACAGATTCGCCGTGCTCTACGGTCTCACAGAGACCGGAGGAAT
CTCCAAGAATGTGGGAGGTCCACTGGGCAGCGAGGGCAGGTTGCTGCGAA
ATGTCCAGGTTCGCGTGGTAGACCCACACGGTCAGTCCTTGGGCCCCAAC
CAGACGGGCCAGATCCTGGTGCGGCTCAACCTTCGCTGGGGCGGCTACTA
TCACAATCCGCAGGAGACCCAGGTGACCGTCACGCCCGACGGCAAGTGGT
TGCTCACCGGCGATCATGGATACTTTGACGATGAGGGCTGCCTGCACTTT
CAGTCCCGTGACACCGATGTCTTCAAGTACAATCACTTCCCCATTTATCC
CAAGCAGATCGAGGACGTGATTCTCCATCTGCCCGGAGTCCACGAAGTGG
CTGTCTTCGGAATTCCCGATGAGGTGTCCACCAATCTTACAGCCTGTGCA
GTGGTTCGGAATGAGGATGAGTTGGGTGCCCAGCTGACCGAGGCGGATGT
CAAGGGAGTTGTGGCACAACATCTAAGCGATGCCTTCCACATCCGCGGAG
GAGTCTTCTTTGTGGACAATCTGCCGAAGACGCAGAACAGTAAGGTGCAG
CGCAGGAAGATCTGGTCGCAGTTGAGCGAGGCAACCACACATTTGGCAAG
CTTTCTAGACCAT

BO26804.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9993-RA 1632 CG9993-PA 1..1629 17..1645 8130 99.9 Plus
CG17999-RA 1638 CG17999-PA 1223..1442 1236..1455 290 75.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG9993-RA 1802 CG9993-RA 78..1706 17..1645 8130 99.9 Plus
CG17999-RA 1691 CG17999-RA 1259..1478 1236..1455 290 75.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20850242..20851208 1645..679 4820 99.9 Minus
2R 25286936 2R 20851706..20852048 359..17 1715 100 Minus
2R 25286936 2R 20851449..20851648 558..359 1000 100 Minus
2R 25286936 2R 20851267..20851386 678..559 600 100 Minus
2R 25286936 2R 20848193..20848412 1455..1236 290 75.5 Minus
Blast to na_te.dros performed on 2014-11-28 02:39:30 has no hits.

BO26804.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:24 Download gff for BO26804.complete
Subject Subject Range Query Range Percent Splice Strand
CG9993-RA 74..1702 17..1647 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:03 Download gff for BO26804.complete
Subject Subject Range Query Range Percent Splice Strand
CG9993-RA 78..1706 17..1647 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:15:54 Download gff for BO26804.complete
Subject Subject Range Query Range Percent Splice Strand
CG9993-RA 78..1706 17..1647 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:15:54 Download gff for BO26804.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20851706..20852048 17..359 100   Minus
2R 20851449..20851647 360..558 100 <- Minus
2R 20851267..20851386 559..678 100 <- Minus
2R 20850239..20851208 679..1647 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:03 Download gff for BO26804.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16739211..16739553 17..359 100   Minus
arm_2R 16738954..16739152 360..558 100 <- Minus
arm_2R 16738772..16738891 559..678 100 <- Minus
arm_2R 16737744..16738713 679..1647 99 <- Minus

BO26804.pep Sequence

Translation from 16 to 1663

> BO26804.pep
MASTKYDSFEKIWSGPKDKEYYGPDMTLGEVALIILRLYSDKVMQVYDPT
GEELTGSQLLEQSRRLAHAFQRLKLQRGDVVGISAKNTTYLTEVVIAALL
NGTPINPLHPDFDAETTAYMFEITKPKVIFCDLDNYQTLSAVKSSLKFKT
EIILLTGTLPGVRNIQDLLADGCTGYDEKTLFACPHLCGDDTAFIITSSG
VTGLPKGVTRSHRSLLNSAKIPQLFTSDTVLFCFSPLYWISCIFTLLASL
VNGCRRIITNRPFSVAYFADLVERHQVSFVLTVPHHMALLAKSPERQELA
AKMQCVQSFVCSGSKVPMGIWRQLYELLGANRFAVLYGLTETGGISKNVG
GPLGSEGRLLRNVQVRVVDPHGQSLGPNQTGQILVRLNLRWGGYYHNPQE
TQVTVTPDGKWLLTGDHGYFDDEGCLHFQSRDTDVFKYNHFPIYPKQIED
VILHLPGVHEVAVFGIPDEVSTNLTACAVVRNEDELGAQLTEADVKGVVA
QHLSDAFHIRGGVFFVDNLPKTQNSKVQRRKIWSQLSEATTHLASFLDH

BO26804.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG9993-PA 543 CG9993-PA 1..543 1..543 2851 100 Plus
CG17999-PA 545 CG17999-PA 7..533 6..532 1550 55.9 Plus
CG11453-PA 539 CG11453-PA 4..526 2..535 791 35.9 Plus
CG8834-PA 535 CG8834-PA 3..521 1..530 751 34.3 Plus
CG4830-PA 534 CG4830-PA 8..521 6..530 742 35 Plus