Clone BO26809 Report

Search the DGRC for BO26809

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptCG13594-RA
Protein status:BO26809.pep: Imported from assembly
Sequenced Size:1468

Clone Sequence Records

BO26809.complete Sequence

1468 bp assembled on 2010-08-18

GenBank Submission: KX796669

> BO26809.complete
GAAGTTATCAGTCGACATGGCCCAGACGATGGACGACATGGTCTTCCAGT
GCAGCAATCAAAACTCGATCTATGTGCTGAATGCCAGCTACGGTTCCTAT
GGGGACTATGGCACATATGCGGCAACAAAGCGTGAAATAAATGGCAGCCG
GAGCAGAGCAGCAAATCCAATTGGGTCGACTTGCTCGAGTGGCGTCCTGC
AGCATAAATTCAAAACTTTCGGCAGTGCCGCAGCAACAGCAGCAGCCGCG
GCAGCTGCAGCGCCACCAGCCATGGATGCAGCAGCGGGAGGCGCAGCAAA
CTACGTAAATCCTGTCGCTACATCAATGTCAACCGCAATGTGTTCACCGG
CAACGGCGGCAACGGCGGCCCTGCAAAAACTGTTCAATTGCAGCGTCGGC
GTCGCCTGCCAAAATGTCACCCACGCCCACAGCAACCACACCAACCAAGG
CAGCAGCAGCATCAGCAGCAGCCACATCCACATCAGTGGCAGCAACAACA
ATGCCGCCGCCAGCAACCATAACAATAGCTGCCTGTCGGCGGCAGGCGGA
GTGGGCCTCCAAGGCGCCCGGAATCGGAGCCGGAGTGGCGAATGCCTCGA
TGGCGCGGCGGGAGCGGTTACCTCGCCAGCCGGAGGCGGAGGAGCAGGTG
GCCTCCCTCTGCTCCCAAAGAAGAAATGCACCAATGTCAAATCAGCGCTT
ATTGCCAAGAAGACAAAGTTTCTCAAATATCTCGAAGAAGAAAAATGGCG
CAGCAACGCGGCAGTTCCGGAAGATGCTGGTGCCATCAGCAATGAGGCGG
AGCCATCCACCCCGAGCGGCAACAACAACGGCGGCAACTTGAAAAATCAG
AGCAACAGTCGGGAGGCTGGAAGTGGCACTGGAAGTGGCAGTGGAAGTGG
ATGTGGAAGTGGGGGGCAGCCGAACAAACCGACCAACTGGAGCATGCATA
ATGAGGACACCAGCACGTCGCTGGCCAGCCACCAGCAACTACAACAGCAG
GCGAAATCGAGTTCCGAGCTCTACCAGGAGGCAGCCGACATTTTGGGCCT
GAGTTGCAGCCTCTGTGATAATTGCCGATGCCTGGACTGCCAGAGCGGCT
ACTTTGACTGCGACGACGACGATGAGAGCTACTCAGAGCAATCGCTGATG
GACGACGAGTACGACGAGTTCGACTGCGGTGCGGAGGAGCTGCAGGCGGC
GATGACAGCAGCCCGGCACCAGGATGTGCCCCGGATGCCCTGCTGCCCGC
TGGGGGCGAGTTCCCACCTTGCGCACAAGGTGGACTCCCCGGCCGTACAT
ATGCCCCCGCAATCGGAATCCCTGGGCCATCGGGTGGCCATCGATTTTGA
TTTAATTAACGCCACTTGCAGCCAGGTGCTGCAAAACTGTGAAACATTCA
ACGATTTGAGTCTGCTAGATTCCGCCGCCGGAGCCGAGCGTCCTTTCACG
GCAAGCTTTCTAGACCAT

BO26809.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG13594-RB 1437 CG13594-PB 1..1434 17..1450 7170 100 Plus
CG13594-RA 1437 CG13594-PA 1..1434 17..1450 7170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13594-RB 2855 CG13594-RB 636..2069 17..1450 7170 100 Plus
CG13594-RA 2896 CG13594-RA 677..2110 17..1450 7170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24623673..24624359 789..103 3435 100 Minus
2R 25286936 2R 24620711..24621070 1450..1091 1800 100 Minus
2R 25286936 2R 24621348..24621654 1093..787 1535 100 Minus
2R 25286936 2R 24624459..24624543 104..20 425 100 Minus
Blast to na_te.dros performed 2014-11-28 02:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2316..2427 418..529 254 69.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2400..2667 228..502 251 57.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6731..6965 318..541 248 60.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2268..2505 298..532 246 58.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6704..6921 312..524 241 58.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6739..6880 390..534 241 66 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2334..2439 418..532 202 69.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6692..6836 397..532 190 63.4 Plus
roo 9092 roo DM_ROO 9092bp 1079..1187 427..536 188 66.1 Plus
roo 9092 roo DM_ROO 9092bp 1079..1153 451..525 168 69.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1502..1598 427..529 166 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2740..2885 418..562 149 62 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1518..1584 466..532 146 68.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6818 439..532 145 62.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2373 459..529 132 67.6 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 120..217 452..548 118 59.2 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9150..9247 452..548 118 59.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6785 461..529 113 69 Plus

BO26809.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:25 Download gff for BO26809.complete
Subject Subject Range Query Range Percent Splice Strand
CG13594-RA 676..2109 17..1452 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:05 Download gff for BO26809.complete
Subject Subject Range Query Range Percent Splice Strand
CG13594-RA 677..2110 17..1452 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:15:55 Download gff for BO26809.complete
Subject Subject Range Query Range Percent Splice Strand
CG13594-RA 677..2110 17..1452 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:15:55 Download gff for BO26809.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24624460..24624544 17..103 97   Minus
2R 24623673..24624358 104..789 100 <- Minus
2R 24621348..24621651 790..1093 100 <- Minus
2R 24620709..24621067 1094..1452 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:05 Download gff for BO26809.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20511983..20512067 17..103 97   Minus
arm_2R 20511196..20511881 104..789 100 <- Minus
arm_2R 20508871..20509174 790..1093 100 <- Minus
arm_2R 20508232..20508590 1094..1452 99 <- Minus

BO26809.pep Sequence

Translation from 16 to 1468

> BO26809.pep
MAQTMDDMVFQCSNQNSIYVLNASYGSYGDYGTYAATKREINGSRSRAAN
PIGSTCSSGVLQHKFKTFGSAAATAAAAAAAAPPAMDAAAGGAANYVNPV
ATSMSTAMCSPATAATAALQKLFNCSVGVACQNVTHAHSNHTNQGSSSIS
SSHIHISGSNNNAAASNHNNSCLSAAGGVGLQGARNRSRSGECLDGAAGA
VTSPAGGGGAGGLPLLPKKKCTNVKSALIAKKTKFLKYLEEEKWRSNAAV
PEDAGAISNEAEPSTPSGNNNGGNLKNQSNSREAGSGTGSGSGSGCGSGG
QPNKPTNWSMHNEDTSTSLASHQQLQQQAKSSSELYQEAADILGLSCSLC
DNCRCLDCQSGYFDCDDDDESYSEQSLMDDEYDEFDCGAEELQAAMTAAR
HQDVPRMPCCPLGASSHLAHKVDSPAVHMPPQSESLGHRVAIDFDLINAT
CSQVLQNCETFNDLSLLDSAAGAERPFTASFLDH

BO26809.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13594-PB 478 CG13594-PB 1..478 1..478 2510 100 Plus
CG13594-PA 478 CG13594-PA 1..478 1..478 2510 100 Plus
CG3257-PA 447 CG3257-PA 143..422 98..374 194 25.4 Plus