Clone BO26814 Report

Search the DGRC for BO26814

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:14
Vector:pDNR-Dual
Associated Gene/TranscriptPyK-RA
Protein status:BO26814.pep: Imported from assembly
Sequenced Size:1633

Clone Sequence Records

BO26814.complete Sequence

1633 bp assembled on 2010-08-18

GenBank Submission: KX799161

> BO26814.complete
GAAGTTATCAGTCGACATGGTGAACGTAACCATCTACGATGAGGCACCGC
AGCTGAAGCCCAACGAAGTACCCCAAAACATGGCCGCAGGAGCTGATACC
CAACTGGAGCACATGTGCCGTCTGCAGTTCGACTCGCCAGTGCCCCATGT
GCGTCTGTCCGGAATCGTGTGCACCATCGGACCTGCCTCCAGCAGCGTGG
AGATGCTGGAGAAGATGATGGCCACCGGCATGAACATCGCGCGCATGAAC
TTCTCTCACGGATCGCACGAGTACCATGCCGCCACCGTGGCCAATGTGCG
CCAGGCGGTGAAGAACTACTCGGCCAAGCTGGGCTACGAACACCCCGTGG
CCATTGCCCTGGACACCAAGGGGCCCGAGATCCGTACCGGTCTGATCGGA
GGCAGCGGCACCGCCGAGATTGAGCTGAAGAAGGGCGAGAAGATCAAGCT
GACCACCAACAAGGAATTCCTGGAGAAGGGCTCTCTGGAGATTGTGTACG
TGGACTACGAGAACATTGTCAATGTGGTGAAGCCCGGCAACCGGGTGTTC
GTCGATGACGGTCTGATCTCACTGATTGTCCGCGAGGTAGGCAAGGATTC
CCTCACCTGCGAGGTGGAGAACGGCGGCTCTCTGGGTTCCCGCAAGGGTG
TGAACCTGCCAGGCGTGCCCGTCGATCTGCCTGCCGTCTCCGAGAAGGAT
AAGAGCGATCTGCTGTTCGGTGTGGAGCAGGAAGTGGACATGATCTTTGC
TTCGTTCATCCGCAACGCCGCTGCTTTGACCGAGATCCGTAAGGTTCTTG
GCGAGAAGGGCAAGAACATCAAGATCATTTCCAAGATCGAGAACCAGCAG
GGCATGCACAACCTGGACGAGATCATCGAGGCCGGTGATGGCATTATGGT
GGCCCGTGGAGATCTGGGTATTGAGATTCCCGCCGAGAAGGTGTTCCTCG
CCCAGAAGGCCATGATTGCCCGCTGCAACAAGGCTGGCAAGCCTGTGATC
TGCGCCACTCAGATGTTGGAGTCAATGGTGAAGAAGCCACGTCCCACTCG
CGCTGAGATCTCTGATGTGGCCAACGCTGTGCTCGATGGTGCTGATTGCG
TCATGTTGTCTGGTGAGACCGCCAAGGGCGAGTACCCGCTGGAGTGCGTC
CTGACCATGGCCAAGACCTGCAAGGAGGCCGAGGCTGCCCTCTGGCACCA
GAACCTCTTTAACGACTTGGTTCGCGGCGCTGGTACCATCGATGCCTCTC
ACGCGGCTGCCATCGCTGCCGTTGAGGCTGCCACCAAGGCCAAGGCCTCC
GCCATCGTGGTGATCACCACCAGCGGCAAGTCGGCCTTCCAGGTGAGCAA
GTACCGCCCACGCTGCCCCATCATCGCGGTCACCCGTTTCGCGCAGACCG
CCCGACAGGCCCATCTCTACCGTGGACTGGTGCCACTCATCTACAAGGAG
CCCGGTCTTGGTGACTGGCTGAAGGACGTGGACGTGCGCGTGCAGTTCGG
TCTGCAGGTCGGAAAGAAGAACGGCTTCATCAAGACCGGCGATTCCGTCG
TGGTGGTTACCGGCTGGAAGCAGGGCTCCGGCTTCACCAACACCATCCGC
ATTGTCACCGTCGAAGCAAGCTTTCTAGACCAT

BO26814.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
PyK-RA 1602 CG7070-PA 1..1599 17..1615 7995 100 Plus
PyK-RB 1539 CG7070-PB 1..1536 80..1615 7680 100 Plus
CG7069-RA 2235 CG7069-PA 386..944 612..1170 530 73 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
PyK-RA 2109 CG7070-RA 243..1841 17..1615 7995 100 Plus
PyK-RB 1958 CG7070-RB 132..1690 57..1615 7795 100 Plus
CG7069-RA 2693 CG7069-RA 736..1294 612..1170 530 73 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22370776..22372167 57..1448 6960 100 Plus
3R 32079331 3R 22372225..22372382 1448..1605 790 100 Plus
3R 32079331 3R 22373622..22374180 612..1170 530 73 Plus
3R 32079331 3R 14753414..14753603 1163..974 290 76.8 Minus
3R 32079331 3R 22369524..22369565 17..58 210 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:39:42 has no hits.

BO26814.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:27 Download gff for BO26814.complete
Subject Subject Range Query Range Percent Splice Strand
PyK-RA 317..1915 17..1617 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:06 Download gff for BO26814.complete
Subject Subject Range Query Range Percent Splice Strand
PyK-RA 243..1841 17..1617 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:15:56 Download gff for BO26814.complete
Subject Subject Range Query Range Percent Splice Strand
PyK-RA 243..1841 17..1617 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:15:56 Download gff for BO26814.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22372226..22372384 1449..1611 97   Plus
3R 22370778..22372167 59..1448 100 -> Plus
3R 22369524..22369565 17..58 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:06 Download gff for BO26814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18197948..18198106 1449..1611 97   Plus
arm_3R 18196500..18197889 59..1448 100 -> Plus
arm_3R 18195246..18195287 17..58 100 -> Plus

BO26814.pep Sequence

Translation from 16 to 1633

> BO26814.pep
MVNVTIYDEAPQLKPNEVPQNMAAGADTQLEHMCRLQFDSPVPHVRLSGI
VCTIGPASSSVEMLEKMMATGMNIARMNFSHGSHEYHAATVANVRQAVKN
YSAKLGYEHPVAIALDTKGPEIRTGLIGGSGTAEIELKKGEKIKLTTNKE
FLEKGSLEIVYVDYENIVNVVKPGNRVFVDDGLISLIVREVGKDSLTCEV
ENGGSLGSRKGVNLPGVPVDLPAVSEKDKSDLLFGVEQEVDMIFASFIRN
AAALTEIRKVLGEKGKNIKIISKIENQQGMHNLDEIIEAGDGIMVARGDL
GIEIPAEKVFLAQKAMIARCNKAGKPVICATQMLESMVKKPRPTRAEISD
VANAVLDGADCVMLSGETAKGEYPLECVLTMAKTCKEAEAALWHQNLFND
LVRGAGTIDASHAAAIAAVEAATKAKASAIVVITTSGKSAFQVSKYRPRC
PIIAVTRFAQTARQAHLYRGLVPLIYKEPGLGDWLKDVDVRVQFGLQVGK
KNGFIKTGDSVVVVTGWKQGSGFTNTIRIVTVEASFLDH

BO26814.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
PyK-PA 533 CG7070-PA 1..533 1..533 2706 100 Plus
PyK-PB 512 CG7070-PB 1..512 22..533 2595 100 Plus
CG2964-PA 554 CG2964-PA 14..513 28..530 1268 47.8 Plus
CG7069-PA 744 CG7069-PA 1..461 72..532 1257 56.4 Plus
CG7362-PB 793 CG7362-PB 109..413 212..514 704 49.8 Plus