Clone BO26819 Report

Search the DGRC for BO26819

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptCG14960-RA
Protein status:BO26819.pep: Imported from assembly
Sequenced Size:1027

Clone Sequence Records

BO26819.complete Sequence

1027 bp assembled on 2010-08-18

GenBank Submission: KX799063

> BO26819.complete
GAAGTTATCAGTCGACATGTTTCTCACAAAGAGTTCAAGTGCGCGGCACT
CGTTGCTGCTGCTTCTGTTGGCCTTTTGCTGCCTGAGCAATGCCTTTGCA
GCCAAGATAACGAAGAAGGTCGAAAAAACGTCGGAAAAGCCAGAGGTGGA
GGCTGCTGCATCGCCAATCGAGGAGGAAAATGACGATGAAGATGCTGGCG
AGGATGGTGATGACGACGACGACGACGAGGAGGAGGAGACGGGGGAACCT
GCGGTGGATGCGGCTGACAAAGAAGCTGCAGTAGGGGCATCGAGTAACAA
GAACCCCAATGCAGTGCAGGCAGCCACGGATCCCACAGATCTCAGTGTCT
GGGGCATGGTTCGCACTCTGTGGGGCTGGCTTCGTAGCGATCTGAGTGAA
AGCCTATTCGGCGATGACGACGACGGGAAGCCCGCGTCCGGCAGCTCAGC
TGTGGAGGGTCGTACCTTTGGCAAAATCCGCCGTCTTCAAATGGCTTTGA
TACCCATTATCTTTAAGTTTGGCGTCCTTTCGGCTATGGTTGCCTTTCTG
GTCGCCATTGGTATGAAGTCTCTGTTCCTGCTCAAGGTCTTAGTGGTTAT
GAATGCCATTGCCATTCTGGGAAAGTTCATTACCCTGAAGTCCAGTCTAT
TTGGACAGTATGAGAACACGGCGCCGTCCTTCAATTACCCGGGCTGGAAT
CCTCATGCCAAGGAGTCGTGGGGCACCACTGGATTGAGTGGTCATGGCGC
TGGTCATCCACCCAGCAAGGAGATTCACCTGCACATCCACGGAAATGCCC
AGACCCAGGCTCAGCTCGCCGGTCAGGGCTATCAGTATGAATCGCAGTCG
GGTGGATGGGCCAGTCGATCGGATCCCTATGGAGCCTATGCACCCACGGG
CCAATTCACCGATAGCCAGCCCGTGGGAGCAGTGGCCGGAGAGGTGCCCA
ACAATACGGATCCCATGTCCCTGCTGCCCACGAAATATCGGGCGAGACAA
CTCATCCGCGCAAGCTTTCTAGACCAT

BO26819.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14960-RA 996 CG14960-PA 1..993 17..1009 4965 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG14960-RA 1444 CG14960-RA 242..1234 17..1009 4965 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3275491..3276045 455..1009 2775 100 Plus
3L 28110227 3L 3274044..3274480 19..455 2185 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:39:47 has no hits.

BO26819.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:28 Download gff for BO26819.complete
Subject Subject Range Query Range Percent Splice Strand
CG14960-RA 246..1232 23..1011 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:08 Download gff for BO26819.complete
Subject Subject Range Query Range Percent Splice Strand
CG14960-RA 248..1234 23..1011 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:15:58 Download gff for BO26819.complete
Subject Subject Range Query Range Percent Splice Strand
CG14960-RA 248..1234 23..1011 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:15:58 Download gff for BO26819.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3275492..3276045 456..1011 99   Plus
3L 3274048..3274480 23..455 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:08 Download gff for BO26819.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3275492..3276045 456..1011 99   Plus
arm_3L 3274048..3274480 23..455 100 -> Plus

BO26819.pep Sequence

Translation from 16 to 1027

> BO26819.pep
MFLTKSSSARHSLLLLLLAFCCLSNAFAAKITKKVEKTSEKPEVEAAASP
IEEENDDEDAGEDGDDDDDDEEEETGEPAVDAADKEAAVGASSNKNPNAV
QAATDPTDLSVWGMVRTLWGWLRSDLSESLFGDDDDGKPASGSSAVEGRT
FGKIRRLQMALIPIIFKFGVLSAMVAFLVAIGMKSLFLLKVLVVMNAIAI
LGKFITLKSSLFGQYENTAPSFNYPGWNPHAKESWGTTGLSGHGAGHPPS
KEIHLHIHGNAQTQAQLAGQGYQYESQSGGWASRSDPYGAYAPTGQFTDS
QPVGAVAGEVPNNTDPMSLLPTKYRARQLIRASFLDH

BO26819.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG14960-PA 331 CG14960-PA 1..331 1..331 1719 100 Plus