Clone BO26827 Report

Search the DGRC for BO26827

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:27
Vector:pDNR-Dual
Associated Gene/TranscriptCG1665-RA
Protein status:BO26827.pep: Imported from assembly
Sequenced Size:1054

Clone Sequence Records

BO26827.complete Sequence

1054 bp assembled on 2010-08-18

GenBank Submission: KX799610

> BO26827.complete
GAAGTTATCAGTCGACATGGCAACCGGCGGAAATAACTCGACCTTTGACC
TCAGTCCCAAGACCCTGGCGGCCGTGGGCGTGGGCCTGGTGGCGGTGGGC
GGGGCTAGCTTCCTACTGTACCGCCATCTGACCCGCGATGTGGTTCCCCA
AAAGTGGCGACGCGTGGGCACCGTGGAGAGGATACACTTTTTTCCGGTCA
AGTCCTGTGCCCCTATGGACATCTCGAAGCCCGGAGTGGAGTACGACTGC
GATGTACTGAGCATGTCCTTTGAGGGAATAAGGGATCGCACCTTGATGGT
GGTCAATGAAAAGAACGAAATGATCACGGCTCGGGTGTATCCGCTTATGA
CCCAGATCAAGTCGAAGAAGGTGTCGCCCAGCAAGCTTGTGTTCAGCGCC
CAGGACATGCCAGACCTGGAGCTGGACTTCGAGAAGCTGGACGGTCCTGG
CAAGGATGTGAAAACTTCCGTTTGGGGCGTTTCCATAGACGTGATGCCCT
GCGGAGATCGGATCAACACGTGGTTCTCCCAGGCCATCCTGAAGAAGGAG
AGCGGCCTCAAGCTAGTTCACTATCCCTATCCGAAACCAGTGAGATGCAC
CAATCCCCGCCTAAAGTCCATGCCATTCATTAGACAGGAGGACTCGGGCA
CTTTTAACGATGCCACCAGCTTTATGCTGATGAACCTTTCGTCGGTCGCC
GATCTTAATACTCGGTTAAAGAATCCGGTGGATGCACTGCAGTTCCGAGG
TAACTTCGAACTGAAAATGGATGTTGATGAGCCCTATGCCGAGGACAATT
GGCAGTGGGTGCGTATAGGCGAAGATGCTGTTTTCCGTACGGTGGCGCCA
TGCACTCGCTGTATTTTTACCAACATTAATGCGAAGACCGCAGAGAGGAG
TTCCGAAGGAGAGCCTCTCAAAACGCTCAGAAGCTATCGCTTGTTCAACT
ACAGTTCGCCGGCTCTGGGCGTTCATATGGGACTTCGGCTGCCGGGAAAG
GTGAAGGCCAACGACGTCGTGTATGTGGAGGACAAGGCAAGCTTTCTAGA
CCAT

BO26827.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG1665-RA 1023 CG1665-PA 1..1020 17..1036 5100 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG1665-RA 1189 CG1665-RA 53..1072 17..1036 5100 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9839889..9840516 20..647 3125 99.8 Plus
2R 25286936 2R 9840583..9840870 646..933 1440 100 Plus
2R 25286936 2R 9840942..9841046 932..1036 525 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:39:57 has no hits.

BO26827.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:30 Download gff for BO26827.complete
Subject Subject Range Query Range Percent Splice Strand
CG1665-RA 38..1057 17..1038 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:13 Download gff for BO26827.complete
Subject Subject Range Query Range Percent Splice Strand
CG1665-RA 53..1072 17..1038 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:01 Download gff for BO26827.complete
Subject Subject Range Query Range Percent Splice Strand
CG1665-RA 53..1072 17..1038 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:01 Download gff for BO26827.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9840944..9841046 934..1038 98   Plus
2R 9840584..9840870 647..933 100 -> Plus
2R 9839887..9840515 17..646 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:13 Download gff for BO26827.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5728449..5728551 934..1038 98   Plus
arm_2R 5728089..5728375 647..933 100 -> Plus
arm_2R 5727392..5728020 17..646 99 -> Plus

BO26827.pep Sequence

Translation from 16 to 1054

> BO26827.pep
MATGGNNSTFDLSPKTLAAVGVGLVAVGGASFLLYRHLTRDVVPQKWRRV
GTVERIHFFPVKSCAPMDISKPGVEYDCDVLSMSFEGIRDRTLMVVNEKN
EMITARVYPLMTQIKSKKVSPSKLVFSAQDMPDLELDFEKLDGPGKDVKT
SVWGVSIDVMPCGDRINTWFSQAILKKESGLKLVHYPYPKPVRCTNPRLK
SMPFIRQEDSGTFNDATSFMLMNLSSVADLNTRLKNPVDALQFRGNFELK
MDVDEPYAEDNWQWVRIGEDAVFRTVAPCTRCIFTNINAKTAERSSEGEP
LKTLRSYRLFNYSSPALGVHMGLRLPGKVKANDVVYVEDKASFLDH

BO26827.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG1665-PA 340 CG1665-PA 1..340 1..340 1784 100 Plus