Clone BO26843 Report

Search the DGRC for BO26843

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:43
Vector:pDNR-Dual
Associated Gene/TranscriptCG6766-RA
Protein status:BO26843.pep: Imported from assembly
Sequenced Size:1609

Clone Sequence Records

BO26843.complete Sequence

1609 bp assembled on 2010-08-18

GenBank Submission: KX799928

> BO26843.complete
GAAGTTATCAGTCGACATGGGCAAGTCCTACGTGATAATTGCGAGAATAG
CATTGCTGCTGAATTTAATAATTGCAGCGGTTTCCCACGAAGCCAAAGAT
TTTGACGATTCAATTTTGTATAAAATTGATTTCGAAGTGCCGGATTTAGA
TGTGCAGCCAAGCTTGGGCAATCAGCTGCGAACATTCTACACGCCGGATA
AGGAGAAGTACGACTGCCTGATTCCCACTTTGGAACACCAAAAAGAGGAG
GAAAAGTCCGACAAGCCAGAGTTGTCTCCAATTACTCTGCTGCAGCCCAT
TTTCTCCGCCCTGACTTGCACGTACCGCATCGAGGCCTACTGGTCGTACG
AAATCTGCCATGGCCACCATGTGCGTCAGTATCACGAGGAGCGCGAAGGA
AAGAACGTCAAGTTCCAGGAGTACTACCTGGGCAAATGGACCGATGAAAA
GATGGAAATACTGACAAAAGCCTGGCAAGCAGACATCAAGGCGGGCGTTA
AGCCGAAATACAAAAGCCTGAAGATCGACAACACTCGGTATCCATACTTT
GAGATGGAATACAGCGATGGCACTATGTGCGACATAATTAACGCTCCTCG
CACCACAATGGTGCGTTATGTGTGCTATCCCCATGGTAAGAACGATATCT
ACTCCTTCAAGGAGACATCCTCGTGCAATTATGAGGCCATTATACTTTCC
TCGGCGCTGTGCCCAATTCGCGCCCTTCATGCCGAAGAGACCAAGGAACT
ATCCATACAATGTTTCAACTCCGAATCGAAACCGCACAGACCGCTGAGCA
TGCTGCGGTCGGAGCTAAAGGAATGGGTTGAATCCGAGGCGGATCTGCTG
GTTTTCAAGGAAAAGGCTACGGAAAATCTGTGGCCCAAGACGGATGGCGA
TTTGGTCACCCTTAACTATGGCGGTGATATGGAAAAAGTCCTGCTCGAGC
ATTTCAGGAATGGTGACCTGAAGGTAGACGGAGACTTTCAGCAGCTCCTG
CTGTCTATAGCAGCCTCTGAAACTGGACCAACACCCATCACTGATCTGAC
GCCCCTTAAGGACTTTATATCGGGCAAGAACTGCCTAACTGGGGGCAATG
GCTGGTGGAAGTACGAGTTCTGCTATGGCCGACATGTGCGTCAGTTCCAC
AAAGATAAGACCAGCGAAGTGGAGCTCTTTCTTGGCTACTTCTCAGAGGA
AGCGCATCGTGCTTGGTCCAACGCCAACCCGGACAAGGGTGCACGCCGTT
CCGGCTTCACGACATCCATCTGGCACCATTATGGCAAGGGAACCCACTGC
GAACAGATTGGAGTGCCCCGCGAAGTTGACGTGAAGTTAACCTGCACACC
TGTAACGAACAGCGGCACCGCTGTATCCATGTACCTGCTTGAGCCGAAGA
CGTGCCAGTATATCCTGGTCGTGGAGTCGCCCACAATATGTGATCTCATC
CACAACGCCGATTCCCAGGGCCTAGTTAAACTGGAGAATCTGGACAAGAT
CTTGGTTACGGAAACCGATAAGTCGACTACCAGTTCCGCTTCCGCTCCTG
CTCCAGCTCCAACTTCCAGCACAGATGAGGAGAATCACCCAGCAAGCTTT
CTAGACCAT

BO26843.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6766-RA 1578 CG6766-PA 1..1575 17..1591 7845 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6766-RA 1882 CG6766-RA 109..1683 17..1591 7845 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12039384..12040202 1094..276 4095 100 Minus
2L 23513712 2L 12038830..12039328 1591..1093 2465 99.6 Minus
2L 23513712 2L 12040438..12040581 160..17 720 100 Minus
2L 23513712 2L 12040265..12040379 275..161 575 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:40:08 has no hits.

BO26843.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:33 Download gff for BO26843.complete
Subject Subject Range Query Range Percent Splice Strand
CG6766-RA 102..1676 17..1593 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:16 Download gff for BO26843.complete
Subject Subject Range Query Range Percent Splice Strand
CG6766-RA 109..1683 17..1593 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:03 Download gff for BO26843.complete
Subject Subject Range Query Range Percent Splice Strand
CG6766-RA 109..1683 17..1593 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:03 Download gff for BO26843.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12040438..12040581 17..160 100   Minus
2L 12040265..12040379 161..275 100 <- Minus
2L 12039385..12040202 276..1093 100 <- Minus
2L 12038828..12039327 1094..1593 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:16 Download gff for BO26843.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12040438..12040581 17..160 100   Minus
arm_2L 12040265..12040379 161..275 100 <- Minus
arm_2L 12039385..12040202 276..1093 100 <- Minus
arm_2L 12038828..12039327 1094..1593 99 <- Minus

BO26843.pep Sequence

Translation from 16 to 1609

> BO26843.pep
MGKSYVIIARIALLLNLIIAAVSHEAKDFDDSILYKIDFEVPDLDVQPSL
GNQLRTFYTPDKEKYDCLIPTLEHQKEEEKSDKPELSPITLLQPIFSALT
CTYRIEAYWSYEICHGHHVRQYHEEREGKNVKFQEYYLGKWTDEKMEILT
KAWQADIKAGVKPKYKSLKIDNTRYPYFEMEYSDGTMCDIINAPRTTMVR
YVCYPHGKNDIYSFKETSSCNYEAIILSSALCPIRALHAEETKELSIQCF
NSESKPHRPLSMLRSELKEWVESEADLLVFKEKATENLWPKTDGDLVTLN
YGGDMEKVLLEHFRNGDLKVDGDFQQLLLSIAASETGPTPITDLTPLKDF
ISGKNCLTGGNGWWKYEFCYGRHVRQFHKDKTSEVELFLGYFSEEAHRAW
SNANPDKGARRSGFTTSIWHHYGKGTHCEQIGVPREVDVKLTCTPVTNSG
TAVSMYLLEPKTCQYILVVESPTICDLIHNADSQGLVKLENLDKILVTET
DKSTTSSASAPAPAPTSSTDEENHPASFLDH

BO26843.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG6766-PA 525 CG6766-PA 1..525 1..525 2815 100 Plus