Clone BO26844 Report

Search the DGRC for BO26844

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptSRm160-RA
Protein status:BO26844.pep: Imported from assembly
Sequenced Size:2896

Clone Sequence Records

BO26844.complete Sequence

2896 bp assembled on 2010-10-15

GenBank Submission: KX794514

> BO26844.complete
GAAGTTATCAGTCGACATGATGTTCACGGGCACCAATCAGCAGCAGGACA
CGCGGTTCAGCGACAAGGAGAAGAAGCTGATGAAGCAAATGAAGTTCGGC
GATTGCCTGAACAAGAGGGTGGATATGTCGAAAGTCAAGCTGGACGTACT
GCGTCCGTGGATCAGCAAGAAGATCACCGACATCCTGCACATCGAGGACG
ACGTGGTCGTCGAGTTTGTCTACAATCAGCTGGAGGAGGAGAAGTATCCG
TGCCCCAAGAAAATGCAGATCAATATGACGGGCTTCTTGAACGGCCGAAA
TGCCCGCCAGTTTATGGGTGAACTTTGGGCCCTGCTGCTTTCGGCACAGG
AAAGCGATTCGGGTATACCAGCGGAGTTTATACAGCAGAAAAAGGACGAG
ATACTCAAACGGGAGGAGGAACAGCGGCAGCGGGATCGATCGAGATCCCG
TTCGCGTTCCCGCTCCCAACGAGACAGTTCTAGGCGAGATCGGCAGCGTG
ACCGCTCCAAATCCAAGTCCCGCTCCAGATCCCGCTCAATGAAGCCGGCC
AACAACAACGGTTCGGTGCCCAGTGCCGCACGAGAAGCGGCCGCCAATGC
GGCTGCCAAAATCCGTAAACGCGGCTCCTCCTCCGCCGCGCGTCCCGGCT
CCAGGGAGCGGAGATCCAGCCGACGACCACGTTCTCGTTCACGTTCACGC
TCGCGAACCGCCGGCAAAAAGACAGGCTCGGTGGAGCCCGCACCCGCCAA
GACTGTCAACGGCCGCCACTCGACGGACAAGTCCTCGCCGGTACCGCCGG
CCTCCAAGAACAAGTCGCGCTCCCGTTCGCATTCCCGGTCGCGATCGCCG
CGCAGTCGATCTCGATCGCCCAGCGCCAAGCGGTCACGTTCCCGCAGTTC
CTCGCGACGCAGTCGCCGACGAGGACGCTCCAGCAGCATATCTTTGTCGC
CGGAGCGCAACCAGGATCAGTTTGAGCACCGACGCAACAAGAACAGTGTG
CAAAACAAGCGGCAATATCGCAACAATCGCGGGGACTCGGCTAGTTCAAT
GGAGCGCGGTAACGATCGAGGCAGGCAGTTTGGCGGTGGCGGAGGTGGTC
GTCGAGGTGGCAGACGCTTCTCCCCGCGAGGACGCAGTCCGATGCGACAG
GATAATGGCGGTGGCAACGGCGGCAATCGCTTTCAGCGATCCAATTCGCG
TCGCAGGTCGAGATCCAGGCGGCTATCACGCTCGCCTATGCGTTATTCTC
GCTCTCCAAGACGCTTCAACAACCGTCGCCGTTCGCCGATGATGAACTTT
AGAGGTGGAGGACGTGGTGGCGGGCGTGGCGGCGGACATCGGCAGATGTG
GCAGCATCGCGGCGGATCGCCCAACTTCCGCGGTGGCGGGCGCATCCACT
GGCAGGCCAGACACAGTCCTGGCGGCGGAGGACGCGGAGGGGGAGGCGGA
ATGGGTCGCTTCGACAGGCGCCAGTCGCCGCAACAGAATCGCTATAATCG
CGACCACCGCCAGTCGCCAATGCAGCAGAATCAGCCGTTCCGCAAGCAAT
TCTCCCCGCATCAGGGACCGGGACGTCGCTTCTCGTCGCCGCAGCAACGA
CGAAATTCAAGAGATCGTCGCCCCAACTCAAGGGAAAGGCGCAGCTCACC
GGGCGGTGGTGGCGGTCACATGAATCGGTGGGACAACCCGCCGCCTGCAC
GAAACCGGCGCTCATCATCGGGAAGCTCGGCAGGTGGACGGCAACAGCGA
CAGCGCAGTGCCAGTCCGCCGGAGAAACGGCGTAGTAGCCATAGTCGCAG
TCGCAGCCTGAGTCGCAATCGAAGCCGCAGTCGCTCCAGTTCGCAACACA
GTCGCAAGCGCGAGAGTCCAATTGGGCGCTCGTCGGTGGAGTATGCTGGC
CCGGCGGTGAACACCATCGATCTCTGTCGCGAGGAGCAGCAGCGCAAAAA
CAAGCCAGAAACGATCATAGTGCTGGACGAGGGTCCAGCCGTGCGCAGCA
GCTATGCCAGTCTGTCCCGCACGCCCTCACCGTTCCTTAAGCCCCACGAG
CGTCTAGCCGCAGCCAAGGCAGCTGCTGCTGCGTCGGCGGCGGTACCAAA
GAAATCCCGCGATCAGAGCCAGAGCAGCAGTTCGGATAGCAGTGCCGAGA
GCGATGATAGCGAGGAGCAGCCGCGTCGCAAGAAGCAGCCAACCAACATG
GAGACTTCCAAGGGCAAGAAGGAGAAGGTACGGCGCAGCTCGGAGAGCTC
AACCAGCAGCGAACAGAGTGACGACGAGGACAACTCCAGTGGGGATGAGA
GGCTCAAGAAGAAGCTGCAGCAAAGGAAGAGCAAGGAGGCGGCGGCTTTA
AAGGGAAAAGAGAAGGAGCATGAGAAGGAGAAGGACAAGCGGCGCTCGGA
CAAGAAGTCCAAGCGGGGCGCAATCTCCAGCGGCGATGAGGAGTCGACGA
GCAGTCGCAAGCGCGGTCACAAGAAGACGCGTCGGGACGAGGCTGGCGAC
AACAGCGATTCCGAGGACGAGCATGTGCCCAAGAAAAAGCGCAAGAAGGC
GAAGAAGCCGGCGGATTCCAGTGACAGCGACTCAGAGGCCTCCTCCAAGC
GCAAGAAGCATAAGAAACACAAGAAGCACAGCAAGAAGAGCAAGAAGCAT
AAGAAGCACAAGCGGAAGTGCAGTGCCGGCAAGTCGCGGGCGGACAGCAG
TTCCCAGGGCAGCAGCGACGAGGATGAGCAGTTGCCGCACTCGGTTGCGG
CCAAGCGGAATGGAAACGCTGGCAAGCTGGCGCTACTGTTGCCGGGCGCC
TCCGGAGCCGGTGTCATCAACGAGGACCTCGAGAAGCAGCTGCGGGAACG
GGCCCTCAAATCGATGAAGAAGCTGGACGCAAGCTTTCTAGACCAT

BO26844.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
SRm160-RA 2865 CG11274-PA 1..2862 17..2878 14310 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
SRm160-RA 3862 CG11274-RA 433..3294 17..2878 14310 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13037423..13038658 28..1263 6180 100 Plus
3L 28110227 3L 13039404..13040408 1874..2878 5025 100 Plus
3L 28110227 3L 13038728..13039340 1263..1875 3065 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:59:55 has no hits.

BO26844.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:22:56 Download gff for BO26844.complete
Subject Subject Range Query Range Percent Splice Strand
SRm160-RA 428..3289 17..2880 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:05 Download gff for BO26844.complete
Subject Subject Range Query Range Percent Splice Strand
SRm160-RA 433..3294 17..2880 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:21 Download gff for BO26844.complete
Subject Subject Range Query Range Percent Splice Strand
SRm160-RA 433..3294 17..2880 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:21 Download gff for BO26844.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13039405..13040408 1875..2880 99   Plus
3L 13038729..13039339 1264..1874 100 -> Plus
3L 13037423..13038658 28..1263 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:05 Download gff for BO26844.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13032505..13033508 1875..2880 99   Plus
arm_3L 13031829..13032439 1264..1874 100 -> Plus
arm_3L 13030523..13031758 28..1263 100 -> Plus

BO26844.pep Sequence

Translation from 16 to 2896

> BO26844.pep
MMFTGTNQQQDTRFSDKEKKLMKQMKFGDCLNKRVDMSKVKLDVLRPWIS
KKITDILHIEDDVVVEFVYNQLEEEKYPCPKKMQINMTGFLNGRNARQFM
GELWALLLSAQESDSGIPAEFIQQKKDEILKREEEQRQRDRSRSRSRSRS
QRDSSRRDRQRDRSKSKSRSRSRSMKPANNNGSVPSAAREAAANAAAKIR
KRGSSSAARPGSRERRSSRRPRSRSRSRSRTAGKKTGSVEPAPAKTVNGR
HSTDKSSPVPPASKNKSRSRSHSRSRSPRSRSRSPSAKRSRSRSSSRRSR
RRGRSSSISLSPERNQDQFEHRRNKNSVQNKRQYRNNRGDSASSMERGND
RGRQFGGGGGGRRGGRRFSPRGRSPMRQDNGGGNGGNRFQRSNSRRRSRS
RRLSRSPMRYSRSPRRFNNRRRSPMMNFRGGGRGGGRGGGHRQMWQHRGG
SPNFRGGGRIHWQARHSPGGGGRGGGGGMGRFDRRQSPQQNRYNRDHRQS
PMQQNQPFRKQFSPHQGPGRRFSSPQQRRNSRDRRPNSRERRSSPGGGGG
HMNRWDNPPPARNRRSSSGSSAGGRQQRQRSASPPEKRRSSHSRSRSLSR
NRSRSRSSSQHSRKRESPIGRSSVEYAGPAVNTIDLCREEQQRKNKPETI
IVLDEGPAVRSSYASLSRTPSPFLKPHERLAAAKAAAAASAAVPKKSRDQ
SQSSSSDSSAESDDSEEQPRRKKQPTNMETSKGKKEKVRRSSESSTSSEQ
SDDEDNSSGDERLKKKLQQRKSKEAAALKGKEKEHEKEKDKRRSDKKSKR
GAISSGDEESTSSRKRGHKKTRRDEAGDNSDSEDEHVPKKKRKKAKKPAD
SSDSDSEASSKRKKHKKHKKHSKKSKKHKKHKRKCSAGKSRADSSSQGSS
DEDEQLPHSVAAKRNGNAGKLALLLPGASGAGVINEDLEKQLRERALKSM
KKLDASFLDH

BO26844.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
SRm160-PA 954 CG11274-PA 1..954 1..954 4905 100 Plus
CG9915-PC 820 CG9915-PC 21..593 108..779 336 28.7 Plus
CG9915-PB 820 CG9915-PB 21..593 108..779 336 28.7 Plus
CG7971-PG 1062 CG7971-PG 243..1034 123..907 329 23.5 Plus
CG7971-PA 1062 CG7971-PA 243..1034 123..907 329 23.5 Plus
CG7971-PG 1062 CG7971-PG 146..1023 88..932 323 20.9 Plus
CG9915-PC 820 CG9915-PC 66..611 384..960 258 23.9 Plus
CG9915-PB 820 CG9915-PB 66..611 384..960 258 23.9 Plus
CG7971-PG 1062 CG7971-PG 8..430 543..897 201 23.7 Plus
CG7971-PG 1062 CG7971-PG 46..325 664..940 183 27 Plus