Clone BO26857 Report

Search the DGRC for BO26857

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG5116-RA
Protein status:BO26857.pep: Imported from assembly
Sequenced Size:1612

Clone Sequence Records

BO26857.complete Sequence

1612 bp assembled on 2010-08-18

GenBank Submission: KX794747

> BO26857.complete
GAAGTTATCAGTCGACATGTCTGCTCTACGAATATTGGCCCGATTTGTCA
GCACTAGGACTCTGCGAATTCGTCCGATTCTGGAGATTCCCGCACGCTGC
AAGTACACCCAACATCAAGGAGTTAAGGGCATTCGGAACAGGAAGAGCTT
CTTCGAAGCCCAAATTCAGGCAGGTCAACAAGGTGAGGAGGATGCGGACT
TAGAGCGGACAGCCAATAGCGATCTGGCGGATATGCGGTTCTTGGATGAT
CGAGCCTACGACGAGGTGGCTGGAGGAGCCATGAGAATCACACGTGACAT
AGCCAGCTCTCAGCAGGTGCTCATCCTCCAACCGTATGTAAAATGGGCAG
CCAAACGACAGAACGCACCCGTCGATGTTCGGCCCGAGGATCAACTCGCG
GAGGCCACAGCGCTGATCCACTCCCTGCCCAATTGGCAGGTGGCCAGGGC
ATTAAAGGTTCCCCTCGAAAGCCTCGAAAAGAAGACGCTTTTCGGCAGCG
GCAAGCTGGTGGAACTCAAGGAACTGGTCGCCGAATTGCGGCAGGAACGG
CATCTAACTTGCCTGTTTGTCAGCAAGGGGACACTATCATTCGCCCAAAA
ACGTTTCCTGGAGGCGGAGTTTCGCCTGCCAGTAATGGATCGCTATTCCG
TTGTTATACAGATACTAAGACTGCATGCCACCAGCGCCGAAGCAAAACTG
CAGGTAGCCATGGCTGAACTTCCTTACATTTGGGCGCAGGCTAAGGATGC
CAGTGTTACGCAGACGCGTCGTCAGGGCTACGCCTTGACCGATCTGCAGA
AGGAGATTCTGCGAACCAGGGAGCGAAAGTTGCGAGCGGAATTAGATCGT
GTCCGGCGACAGAGGCAGTTGCTTCGCCAGAAAAGAAAACAGCAAAATTA
TCCCATCGTTGCAGTGGTGGGTTACACAAATGCTGGCAAGACTTCCTTGA
TCAAGGCACTCACAGTCGAGGATGCACTGCAGCCCAGGAATCAGTTGTTC
GCAACGCTTGATGTGACTGCTCATGCTGGTTGTTTGCCATGCAATCTGGA
GGTGATCTATATGGACACGGTGGGCTTTATGTCCGATCTGCCAACGGGAC
TGTTTGAATGCTTTGTGGCCACTTTGGAGGATGCCATGCTGGCGGATGTA
ATAGTCCACGTCCAGGATCTTTCCCATCCGTGTCACGCTGCTCAACGCAG
CCATGTGGAGGCCACGCTTCGTTCTTTGGCATTCAACGTGGCTGGCGGAG
ATTCCACGGCCAGCCAGTTGCCGCCGATCATTAATGTGTACAACAAATGT
GATCTTGTTTCCCAAGAGGCTCAGTCGTCTGCAGACCCAGTGCATCATAT
ATCAGCCAGAGCACAGACTGGGCTGGAACCCCTGCTAGATGACATCGAGC
AACAGATATTGACCGCCACCGGGCGAAGAAAACTTCAGATGCGAGTGCCC
AGCGGCGGTCCAGAAATGGCTTGGCTGTACAAAAACGCAGCTGTGGTGGA
AACGACAGCGGATGCGGAGAATCCCGAACGCCTCATGATGCACGTGGTTA
TCAGCCAACGCACACTGGATCAGTTCAAGCGACAGTTTTGCCGAGCAAGC
TTTCTAGACCAT

BO26857.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG5116-RB 1581 CG5116-PB 1..1578 17..1594 7890 100 Plus
CG5116-RA 1581 CG5116-PA 1..1578 17..1594 7890 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG42488-RB 2158 CG42488-RB 409..1987 16..1594 7895 100 Plus
CG5116-RB 2158 CG5116-RB 409..1987 16..1594 7895 100 Plus
CG5116-RA 2380 CG5116-RA 257..1835 16..1594 7895 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25483851..25484304 252..705 2270 100 Plus
3R 32079331 3R 25484860..25485310 1144..1594 2255 100 Plus
3R 32079331 3R 25484359..25484802 702..1145 2220 100 Plus
3R 32079331 3R 25483561..25483797 16..252 1185 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:40:20 has no hits.

BO26857.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:35 Download gff for BO26857.complete
Subject Subject Range Query Range Percent Splice Strand
CG5116-RA 255..1832 17..1596 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:21 Download gff for BO26857.complete
Subject Subject Range Query Range Percent Splice Strand
CG5116-RA 258..1835 17..1596 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:07 Download gff for BO26857.complete
Subject Subject Range Query Range Percent Splice Strand
CG5116-RA 258..1835 17..1596 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:07 Download gff for BO26857.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25484861..25485310 1145..1596 99   Plus
3R 25484361..25484801 704..1144 100 -> Plus
3R 25483852..25484302 253..703 100 -> Plus
3R 25483562..25483797 17..252 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:21 Download gff for BO26857.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21310583..21311032 1145..1596 99   Plus
arm_3R 21310083..21310523 704..1144 100 -> Plus
arm_3R 21309574..21310024 253..703 100 -> Plus
arm_3R 21309284..21309519 17..252 100 -> Plus

BO26857.pep Sequence

Translation from 16 to 1612

> BO26857.pep
MSALRILARFVSTRTLRIRPILEIPARCKYTQHQGVKGIRNRKSFFEAQI
QAGQQGEEDADLERTANSDLADMRFLDDRAYDEVAGGAMRITRDIASSQQ
VLILQPYVKWAAKRQNAPVDVRPEDQLAEATALIHSLPNWQVARALKVPL
ESLEKKTLFGSGKLVELKELVAELRQERHLTCLFVSKGTLSFAQKRFLEA
EFRLPVMDRYSVVIQILRLHATSAEAKLQVAMAELPYIWAQAKDASVTQT
RRQGYALTDLQKEILRTRERKLRAELDRVRRQRQLLRQKRKQQNYPIVAV
VGYTNAGKTSLIKALTVEDALQPRNQLFATLDVTAHAGCLPCNLEVIYMD
TVGFMSDLPTGLFECFVATLEDAMLADVIVHVQDLSHPCHAAQRSHVEAT
LRSLAFNVAGGDSTASQLPPIINVYNKCDLVSQEAQSSADPVHHISARAQ
TGLEPLLDDIEQQILTATGRRKLQMRVPSGGPEMAWLYKNAAVVETTADA
ENPERLMMHVVISQRTLDQFKRQFCRASFLDH

BO26857.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5116-PB 526 CG5116-PB 1..526 1..526 2655 100 Plus
CG5116-PA 526 CG5116-PA 1..526 1..526 2655 100 Plus