Clone BO26862 Report

Search the DGRC for BO26862

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:62
Vector:pDNR-Dual
Associated Gene/Transcriptcrp-RA
Protein status:BO26862.pep: full length peptide match
Sequenced Size:1927

Clone Sequence Records

BO26862.complete Sequence

1927 bp assembled on 2010-09-17

GenBank Submission: KX799817

> BO26862.complete
GAAGTTATCAGTCGACATGTCCGCCGTACCGGTTGCCATCAAAACGGAGG
AAGTTATTCTAGAGCACGCCGAATACAACAGCGCCGAGGAATTGGATGAG
GAATTGCAATTGCAACTAGAGGATTCAGGGGGTGAGAACTATCACATCGA
GTTCGCCAGCGAGTCAGCTCATCAGGGTTCTCAGCGTCGACAGTCGAGCA
TGAGCGGTACGAATACCTCCAAGGGTGGAGGAGGAGGGGGCAGCGGGGCC
TTGAGCGATGGAGACGGTTCGGGAAAGCCCCTTGTGGACAGCGAGAAGCG
AATGCGTCGGGAAATCGCCAACAGCAACGAGCGCAGACGCATGCAGAGCA
TCAATGCCGGATTCCAGAGTCTGCGATCCCTGCTCCCGAGACACGAAGGC
GAGAAGTTGAGCAAGGCGGCCATCCTACAACAGACCTTCCAATACATTGT
GGAACTGGAGAACCAGAAGACGCAGCTGCTGACGCAGAACAGTGAACTGA
AGCGACAGGTGGGCGAGCACGAGGCCGGCGGTTCTGGCGATGGTGGTGGT
ACCAACTCCGGCGGAAACTACAATGATTCCAATGCCAGCGGGGGCAATTC
CACGGCGGTGGCCATCAAGAAACGGAAGCTGACTGATAACGTGATTAACA
TCCAGGCGATTAGTGACAGTTCCGACGAAGGTCTGGGATCGATGTCTCCA
GAGCCGATGACTCTGCTGACAGCCGGCGGAGCGGCGGCCACCAAACTGAG
CAATGCTGCTACTCTTCTGGCGGCCAAGGAGCTGCATGAGTCGAAGAAGC
AGTTGGAGAAGGAGCGCAGTCTGCGGCGACTCCTCGAGGATGAGCTCCAG
ATGATCAAGCGGCAGCTGTACAGCGTGGCAACCGCACCGCCCGGAACAGC
TGTGGCCGCCGCATCCGGCGGCAGTAGTGGCGCCTACATTCCACGTGAGG
TCATCGAGCACACCGATAACTTTGTGCGCAGCGAGGATTTGGAGGAACTT
GGCGGCACTGTCTCGTATGTGGAAATCGATGAAATGACTGGCCAGCAGCA
GGTGGTCGTGTGCTCCAGCATCGAGGAGCTGGAGGCCGATGCCGCTGCCG
AGATCATAACCGAGGATCAGGTGCACGAGGAGGTCATCCTGTCATCGAAC
AGCTCCACAGAGTCCGAGAACGAAGTGAACGTGAACGCAATTGCCAAAGC
CTATGCCGAAGGATGCACGTCGAGTGCTGCGATGCTTCAGCCAATTCTGC
AGGCGGCCATCAAGGCCACGCCCAAGGTGGAGGTGGAACGCATCCACGAG
AAGATTGTCAAGGTCAAGACGGAGAAGCACGATCTGCCATCGATGCAGAC
CGCACCACACTATCAGCATTCTCATCGCCAGAATCTAGAGACCATTGTCC
AGGCCATCAGGCATCTGGAGGGCGATCACCTATTCGCGGACGGCAGTGGG
GGCCAAGAAAAGTTTGGCCAGCAGCAGAATCTCCAGCAGCATCACCACCA
AATGTCTGGAGTTCACCACCAGCAGCTGCAACACCATCGTCTGGCGCAGG
ATGCGCCGCTGGCCCTCACCACCACGGGCAAGCAGCATGCGGCGCTGGCG
GAGCTTCGACCCTTCCTTCAACTCAAGAGCGGCGGCAACAAGCAGGTGAT
CATTACGGCCAAGACGGCCAAGGATTCCGGCGGTTTGGTCTCCACGAGCA
CCAGCAGTACAGCGGTTACGCCGACGGCGATCTTCAAGGTGCAAACAACG
GGCGGTCATGGAAACGGCAGTCATTTACCAGCGGGCTCATCGACGGGCAC
CATAATCACTGGAAGCAATGGCAGCGGTGGTGCCCAGCAGCTGACCATCA
CCACATCGTTGAAGCAGTGCCGACCGGGCGTGATAGTGGCCAAGCAGTTG
CCGTCGTCCGCAAGCTTTCTAGACCAT

BO26862.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
crp-RB 1896 CG7664-PB 1..1893 17..1909 9465 100 Plus
crp-RA 1896 CG7664-PA 1..1893 17..1909 9465 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
crp-RB 4402 CG7664-RB 540..2434 15..1909 9475 100 Plus
crp-RA 3537 CG7664-RA 540..2434 15..1909 9475 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16265524..16267019 1909..414 7480 100 Minus
2L 23513712 2L 16278862..16279169 416..109 1540 100 Minus
2L 23513712 2L 16287098..16287191 108..15 470 100 Minus
Blast to na_te.dros performed 2014-11-28 05:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1085..1157 1469..1541 140 65.8 Plus
roo 9092 roo DM_ROO 9092bp 1060..1143 1468..1551 132 61.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2352..2467 1469..1587 128 58.8 Plus

BO26862.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-17 10:26:24 Download gff for BO26862.complete
Subject Subject Range Query Range Percent Splice Strand
crp-RA 540..2432 17..1911 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:27:12 Download gff for BO26862.complete
Subject Subject Range Query Range Percent Splice Strand
crp-RA 542..2434 17..1911 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:15:43 Download gff for BO26862.complete
Subject Subject Range Query Range Percent Splice Strand
crp-RA 542..2434 17..1911 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:15:43 Download gff for BO26862.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16287098..16287189 17..108 100   Minus
2L 16278863..16279169 109..415 100 <- Minus
2L 16265521..16267017 416..1911 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:27:12 Download gff for BO26862.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16287098..16287189 17..108 100   Minus
arm_2L 16278863..16279169 109..415 100 <- Minus
arm_2L 16265521..16267017 416..1911 99 <- Minus

BO26862.pep Sequence

Translation from 16 to 1927

> BO26862.pep
MSAVPVAIKTEEVILEHAEYNSAEELDEELQLQLEDSGGENYHIEFASES
AHQGSQRRQSSMSGTNTSKGGGGGGSGALSDGDGSGKPLVDSEKRMRREI
ANSNERRRMQSINAGFQSLRSLLPRHEGEKLSKAAILQQTFQYIVELENQ
KTQLLTQNSELKRQVGEHEAGGSGDGGGTNSGGNYNDSNASGGNSTAVAI
KKRKLTDNVINIQAISDSSDEGLGSMSPEPMTLLTAGGAAATKLSNAATL
LAAKELHESKKQLEKERSLRRLLEDELQMIKRQLYSVATAPPGTAVAAAS
GGSSGAYIPREVIEHTDNFVRSEDLEELGGTVSYVEIDEMTGQQQVVVCS
SIEELEADAAAEIITEDQVHEEVILSSNSSTESENEVNVNAIAKAYAEGC
TSSAAMLQPILQAAIKATPKVEVERIHEKIVKVKTEKHDLPSMQTAPHYQ
HSHRQNLETIVQAIRHLEGDHLFADGSGGQEKFGQQQNLQQHHHQMSGVH
HQQLQHHRLAQDAPLALTTTGKQHAALAELRPFLQLKSGGNKQVIITAKT
AKDSGGLVSTSTSSTAVTPTAIFKVQTTGGHGNGSHLPAGSSTGTIITGS
NGSGGAQQLTITTSLKQCRPGVIVAKQLPSSASFLDH

BO26862.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
crp-PB 631 CG7664-PB 1..631 1..631 3166 100 Plus
crp-PA 631 CG7664-PA 1..631 1..631 3166 100 Plus