Clone BO26871 Report

Search the DGRC for BO26871

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptDp-RB
Protein status:BO26871.pep: Imported from assembly
Sequenced Size:1357

Clone Sequence Records

BO26871.complete Sequence

1357 bp assembled on 2010-08-18

GenBank Submission: KX798346

> BO26871.complete
GAAGTTATCAGTCGACATGTGTATATCGGAAACTAAGGAACCTCCGCATC
TTCCAATTTCCAATTCTGCAGGACAAATATCCAAAATGCTGAAGCCGGCC
CAGAACAAGTCCGAAATGGAGGGAGGTAAGCCCGTGGCGGTGGTCTACGC
CACCGGCTCATCCGCGCGCAACAGCGGAAGTGCTAGCGGCATCGGCAACG
TGGGACGCATGGGCGCCTTTAGTCAGATGGGCAGTCAAGGGCAGTTTATA
CGACTGCAGGACAACGGACTGTCCATTCCAAAAACAGAAGCAGGTACCAC
CTACACCACCGTTTCGGCGCAAAAGACTTCGGGTGCTGGCAGTGGTCATT
ACGACTTGCCCTTGAAGGGAGATCGCTATGTGAAGTTTACACCAAATCCC
ATAAAAATGAAATCAAAACTCCATGCCATTCAGAGCAACTCGTTGCACTC
CATGTCGGCCTCCTCATCGTCCGTTCAAAGGAAACGCAAGCCGGACAAGG
CAGGCAAAGGTTTGCGCCATTTCTCGATGAAGGTATGCGAAAAGGTGGAG
GAGAAGGGCAAGACCACCTACAATGAGGTGGCCGACGACCTGGTCAGCGA
GGAGATGAAGAACAATGCGTACGACAACAACTGTGATCAAAAGAATATCC
GACGTCGTGTCTACGATGCGCTCAACGTACTGATGGCAATCAATGTTATT
TCCAAGGACAAGAAGGAGATTCGCTGGATAGGACTGCCCGCAAATTCGAC
AGAGACATTTCTGGCCCTGGAAGAGGAAAACTGTCAGCGCCGCGAGCGAA
TAAAACAGAAAAACGAAATGTTGCGCGAAATGATCATGCAGCATGTGGCG
TTCAAGGGATTGGTCGAGCGGAACAAGCGAAACGAGAGCCAAGGCGTGGT
GCCTTCCCCGAATGCCTCGATCCAGCTACCGTTCATCATCGTGAACACGC
ACAAGTCCACGAAAATCAACTGCAGTGTGACCAACGACAAGTCCGAATAC
ATATTCAAGTTCGACAAAACCTTCGAAATGCACGATGACATTGAGGTGCT
CAAGCGTATGGGATTCCTATTGGGACTGGATAAGGGCGAATGCACGCCGG
AGAACATTGAACGAGTCAAGTCGTGGGTGCCTCCAAACCTTGCCAAATAC
GTAGAAGCCTACGGCACCGGCAAGACTGGCGAAAATATGTACGAATCGGA
TGACGAGGACAATGAGTTCAACGGGTACCTGGAGTCGGCCAATGAGTCCC
AGGGCTTTGCACAACACTCGGCACAACACACCACCGATGGCGAGTTCAAG
CTGGAGATGGATGATGACGAGCTGGACGACGACATTGATGCAAGCTTTCT
AGACCAT

BO26871.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dp-RB 1326 CG4654-PB 1..1323 17..1339 6615 100 Plus
Dp-RA 1338 CG4654-PA 67..1335 71..1339 6345 100 Plus
Dp-RC 1254 CG4654-PC 1..1251 86..1339 6190 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dp-RB 2448 CG4654-RB 91..1413 17..1339 6615 100 Plus
Dp-RA 2526 CG4654-RA 680..1948 71..1339 6345 100 Plus
Dp-RC 1913 CG4654-RC 69..1335 70..1339 6270 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13226002..13226335 421..754 1670 100 Plus
2R 25286936 2R 13226402..13226641 753..992 1200 100 Plus
2R 25286936 2R 13225412..13225625 17..230 1070 100 Plus
2R 25286936 2R 13226984..13227167 1156..1339 920 100 Plus
2R 25286936 2R 13225807..13225938 289..420 660 100 Plus
2R 25286936 2R 13226845..13226929 1073..1157 425 100 Plus
2R 25286936 2R 13226700..13226783 991..1074 420 100 Plus
2R 25286936 2R 13225690..13225751 229..290 310 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:40:31 has no hits.

BO26871.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:38 Download gff for BO26871.complete
Subject Subject Range Query Range Percent Splice Strand
Dp-RB 89..1411 17..1341 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:25 Download gff for BO26871.complete
Subject Subject Range Query Range Percent Splice Strand
Dp-RB 91..1413 17..1341 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:11 Download gff for BO26871.complete
Subject Subject Range Query Range Percent Splice Strand
Dp-RB 91..1413 17..1341 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:11 Download gff for BO26871.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13226986..13227167 1158..1341 98   Plus
2R 13226846..13226929 1074..1157 100 -> Plus
2R 13226700..13226782 991..1073 100 -> Plus
2R 13226404..13226639 755..990 100 -> Plus
2R 13226002..13226335 421..754 100 -> Plus
2R 13225809..13225938 291..420 100 -> Plus
2R 13225691..13225751 230..290 100 -> Plus
2R 13225412..13225624 17..229 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:25 Download gff for BO26871.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9114491..9114672 1158..1341 98   Plus
arm_2R 9114351..9114434 1074..1157 100 -> Plus
arm_2R 9114205..9114287 991..1073 100 -> Plus
arm_2R 9113909..9114144 755..990 100 -> Plus
arm_2R 9113507..9113840 421..754 100 -> Plus
arm_2R 9113314..9113443 291..420 100 -> Plus
arm_2R 9113196..9113256 230..290 100 -> Plus
arm_2R 9112917..9113129 17..229 100 -> Plus

BO26871.pep Sequence

Translation from 16 to 1357

> BO26871.pep
MCISETKEPPHLPISNSAGQISKMLKPAQNKSEMEGGKPVAVVYATGSSA
RNSGSASGIGNVGRMGAFSQMGSQGQFIRLQDNGLSIPKTEAGTTYTTVS
AQKTSGAGSGHYDLPLKGDRYVKFTPNPIKMKSKLHAIQSNSLHSMSASS
SSVQRKRKPDKAGKGLRHFSMKVCEKVEEKGKTTYNEVADDLVSEEMKNN
AYDNNCDQKNIRRRVYDALNVLMAINVISKDKKEIRWIGLPANSTETFLA
LEEENCQRRERIKQKNEMLREMIMQHVAFKGLVERNKRNESQGVVPSPNA
SIQLPFIIVNTHKSTKINCSVTNDKSEYIFKFDKTFEMHDDIEVLKRMGF
LLGLDKGECTPENIERVKSWVPPNLAKYVEAYGTGKTGENMYESDDEDNE
FNGYLESANESQGFAQHSAQHTTDGEFKLEMDDDELDDDIDASFLDH

BO26871.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dp-PB 441 CG4654-PB 1..441 1..441 2292 100 Plus
Dp-PA 445 CG4654-PA 20..445 16..441 2199 99.5 Plus
Dp-PC 417 CG4654-PC 1..417 24..441 2155 99.8 Plus