Clone BO26895 Report

Search the DGRC for BO26895

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG15065-RA
Protein status:BO26895.pep: Imported from assembly
Sequenced Size:154

Clone Sequence Records

BO26895.complete Sequence

154 bp assembled on 2010-08-18

GenBank Submission: KX798609

> BO26895.complete
GAAGTTATCAGTCGACATGAAGTGGATGTCCTTGGTCTTTCTATGCGGTC
TGCTCGCCATGGCAGTGGCTTCTCCGTTAAATCCGGGTAATGTCATTATC
AATGGAGATTGCCGTCATTGTAATGTTCGCGGAGGCGCAAGCTTTCTAGA
CCAT

BO26895.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG15065-RA 123 CG15065-PA 1..120 17..136 600 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15065-RA 218 CG15065-RA 31..150 17..136 600 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18390106..18390174 68..136 345 100 Plus
2R 25286936 2R 18389989..18390040 17..68 260 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:58:41 has no hits.

BO26895.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:53:32 Download gff for BO26895.complete
Subject Subject Range Query Range Percent Splice Strand
CG15065-RA 32..151 17..138 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:03 Download gff for BO26895.complete
Subject Subject Range Query Range Percent Splice Strand
CG15065-RA 31..150 17..138 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:32 Download gff for BO26895.complete
Subject Subject Range Query Range Percent Splice Strand
CG15065-RA 31..150 17..138 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:32 Download gff for BO26895.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18390107..18390174 69..138 97   Plus
2R 18389989..18390040 17..68 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:03 Download gff for BO26895.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14277612..14277679 69..138 97   Plus
arm_2R 14277494..14277545 17..68 100 -> Plus

BO26895.pep Sequence

Translation from 16 to 154

> BO26895.pep
MKWMSLVFLCGLLAMAVASPLNPGNVIINGDCRHCNVRGGASFLDH

BO26895.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG15065-PA 40 CG15065-PA 1..40 1..40 220 100 Plus
IM3-PB 39 CG16844-PB 1..38 1..38 154 76.3 Plus
IM3-PA 39 CG16844-PA 1..38 1..38 154 76.3 Plus
CG15068-PA 40 CG15068-PA 1..39 1..39 149 69.2 Plus
IM2-PA 45 CG18106-PA 1..44 1..40 126 61.4 Plus