Clone BO27103 Report

Search the DGRC for BO27103

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:3
Vector:pDNR-Dual
Associated Gene/TranscriptCG8850-RB
Protein status:BO27103.pep: Imported from assembly
Sequenced Size:1921

Clone Sequence Records

BO27103.complete Sequence

1921 bp assembled on 2010-10-15

GenBank Submission: KX798406

> BO27103.complete
GAAGTTATCAGTCGACATGGATGATGATGCAGAATACCAGAAGCTCCGGC
GAAACATGCAGGGAGCTCAAGGATCGAGAGAAGGACATCCAGGATCAAAT
GATGGCATCAGCACAGTAATCTACAGCGCGGAAGGAGAAGAGCTTACCAT
AAATTGTGAGGCCGAATCCGAGTCATCCGGCCAGCGAGATCAGTGGAGCA
GGGGAGTGGAGTTCCTCTTCTCCTGCATCGCCCTATCCGTTGGCCTTGGC
AATGTCTGGCGATTTCCGTTCATTGCTCTGGAGAATGGCGGTGGCGCCTT
TCTCATACCCTACGTGATTGTGCTCCTGCTGATTGGCAGACCGGTTTACT
ATCTGGAGGTCATCATTGGTCAGTTCTCGAGCCGTGGTTGCATCAGAGCC
TTCGATATGGCACCTATAATGAGGGGTATTGCCTATGGTCAGGTGTATTC
CACCGCCTTGGCCACCACCTACTACGCCTGCATTATGGCCTTGACCATCA
GATATTTGGTGGCTAGTTTCAGTGAAGTCCTGCCCTGGACATATTGCCTC
GTGGAATGGGGCAAAAGTTGCGTGGCGACGGGAGCCACAGCTGCCAATGA
CTCATCCATTGTGCAGGGGGTTTCCTCCGCCGAGCTGTTTTTCACGCAAA
CAGTTCTGAGGGAGCCCGAATCGCTGGACGATAATGGCCTGGGTACTCCC
AGTTGGGATCTGGTCTTGTGTCTCCTGGCCACTTGGGTGATCATCGGCAC
GATTTTGTCAAAGGGCATTCGCAGTTCTGGGAAAGCTTCCTATTTCCTGG
CCCTGTTTCCCTATGTGATCATGATCGTACTGCTCATTCGGGCGGTCACT
TTACCAGGTGCCTGGCAGGGAATTGTGTACTTCCTGAAGCCCCAATGGTC
CCAGCTGCTCAATCCGCACGTGTGGTACGCGGCCATCACACAGATGTTCT
TCTCGCTGGCCATCTGCTTCGGAACGCTGGTCATGTACGCCTCCTTCAAT
GATTTCAACAAGAATGTGCACAAAGATGTGATAATAATCACCACTATAGA
CTCGCTTACATCCATTCTGGCTGGTTGCATCATCTTTGGAATTCTGGGCA
ACCTGGCCTTTGAGACCAACACCAAGGATATTTCGCAGGTTGTCAAAGGT
GGAGCTGGTCTAGCGTTCATTTCCTATCCAGAGGCCATTGCCAAATTCAA
GTACCTTCCCCAACTGTTCGCCGTTCTGTTCTTCTTCATGCTCCTGGTCC
TGGGCATTGGATCGAATATTGGAATGGCTTCGGCTGTGGTGAATGTGGTT
AAGGATCGATTCACCCATTTGCCCCACTGGCTGCTGGCCGTGAGTGCTTC
GATAATTGGATTCCTCTGTGGCCTGGTGTACATGACTCCGGGCGGACAGT
TCGTACTGAATCTCGTCGACTTTTATGGCTGCACTTTTATAGCCCTGGTC
TTGGCCATTGCAGAATTGTTGGCAGTGGGCTGGATTTATGGTGTGAAGCG
CATCTGCAGCGACATTGAGTTCATGCTGAATGTGAAGACCAGCTTCTATT
GGCGCATCTGCTGGGCCATTGTGGCACCTGGTCTGATGTTCCTGGTCCTC
GTCTATATGCTCTTCAGCTACGAACCTCTGACGTACCGAGGTGTTCAGTA
TCCGCCGGTCTACTATATGGCTGGATGGATTATCTGGGGACTGGGTGTGC
TGCAGTTGCCCTTCTGGGCTTTGGTGACGATTTACCAGCAGCCAGGAAAG
ACTTTTGGCAGTAAATTCGGACTGGCCATGCAACCCACTGCCAATTGGGG
TCCATTGCAGACGCAGAAGTTCGAGGCCTACATAATCCATCGAAAACGCG
AGGCGGACTTTAAGAGCCCACGTGGCGGATACTTGTTCGACAATATCTTT
GGCGCAAGCTTTCTAGACCAT

BO27103.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG8850-RB 1890 CG8850-PB 1..1887 17..1903 9435 100 Plus
CG8850-RA 1851 CG8850-PA 1..1848 56..1903 9240 100 Plus
CG1698-RB 1965 CG1698-PB 817..1301 773..1257 400 72.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG8850-RB 2260 CG8850-RB 186..2072 17..1903 9435 100 Plus
CG8850-RA 2086 CG8850-RA 73..1945 31..1903 9365 100 Plus
CG42700-RJ 4712 CG42700-RJ 3055..3793 1762..1024 3695 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12299138..12299876 1762..1024 3695 100 Minus
2R 25286936 2R 12299933..12300310 1023..646 1890 100 Minus
2R 25286936 2R 12300652..12300938 427..141 1435 100 Minus
2R 25286936 2R 12300374..12300595 646..425 1110 100 Minus
2R 25286936 2R 12298935..12299075 1903..1763 705 100 Minus
2R 25286936 2R 12300998..12301123 142..17 630 100 Minus
2L 23513712 2L 14848742..14848905 357..194 325 79.9 Minus
2R 25286936 2R 9796709..9796929 773..993 295 75.6 Plus
2R 25286936 2R 9797070..9797245 1082..1257 250 76.1 Plus
2L 23513712 2L 14845874..14845977 1269..1166 220 80.8 Minus
2R 25286936 2R 18730015..18730155 358..218 210 76.6 Minus
2R 25286936 2R 18729221..18729404 972..789 200 73.9 Minus
Blast to na_te.dros performed on 2014-11-26 15:06:40 has no hits.

BO27103.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:14 Download gff for BO27103.complete
Subject Subject Range Query Range Percent Splice Strand
CG8850-RB 112..1998 17..1905 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:03 Download gff for BO27103.complete
Subject Subject Range Query Range Percent Splice Strand
CG8850-RB 186..2072 17..1905 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:41 Download gff for BO27103.complete
Subject Subject Range Query Range Percent Splice Strand
CG8850-RB 186..2072 17..1905 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:41 Download gff for BO27103.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12300998..12301123 17..142 100   Minus
2R 12300654..12300936 143..425 100 <- Minus
2R 12300375..12300594 426..645 100 <- Minus
2R 12299933..12300310 646..1023 100 <- Minus
2R 12299138..12299876 1024..1762 100 <- Minus
2R 12298933..12299075 1763..1905 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:03 Download gff for BO27103.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8188503..8188628 17..142 100   Minus
arm_2R 8188159..8188441 143..425 100 <- Minus
arm_2R 8187880..8188099 426..645 100 <- Minus
arm_2R 8187438..8187815 646..1023 100 <- Minus
arm_2R 8186643..8187381 1024..1762 100 <- Minus
arm_2R 8186438..8186580 1763..1905 98 <- Minus

BO27103.pep Sequence

Translation from 16 to 1921

> BO27103.pep
MDDDAEYQKLRRNMQGAQGSREGHPGSNDGISTVIYSAEGEELTINCEAE
SESSGQRDQWSRGVEFLFSCIALSVGLGNVWRFPFIALENGGGAFLIPYV
IVLLLIGRPVYYLEVIIGQFSSRGCIRAFDMAPIMRGIAYGQVYSTALAT
TYYACIMALTIRYLVASFSEVLPWTYCLVEWGKSCVATGATAANDSSIVQ
GVSSAELFFTQTVLREPESLDDNGLGTPSWDLVLCLLATWVIIGTILSKG
IRSSGKASYFLALFPYVIMIVLLIRAVTLPGAWQGIVYFLKPQWSQLLNP
HVWYAAITQMFFSLAICFGTLVMYASFNDFNKNVHKDVIIITTIDSLTSI
LAGCIIFGILGNLAFETNTKDISQVVKGGAGLAFISYPEAIAKFKYLPQL
FAVLFFFMLLVLGIGSNIGMASAVVNVVKDRFTHLPHWLLAVSASIIGFL
CGLVYMTPGGQFVLNLVDFYGCTFIALVLAIAELLAVGWIYGVKRICSDI
EFMLNVKTSFYWRICWAIVAPGLMFLVLVYMLFSYEPLTYRGVQYPPVYY
MAGWIIWGLGVLQLPFWALVTIYQQPGKTFGSKFGLAMQPTANWGPLQTQ
KFEAYIIHRKREADFKSPRGGYLFDNIFGASFLDH

BO27103.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG8850-PB 629 CG8850-PB 1..629 1..629 3299 100 Plus
CG8850-PA 616 CG8850-PA 1..616 14..629 3230 100 Plus
CG1698-PB 654 CG1698-PB 73..654 56..629 1834 57.1 Plus
CG1698-PA 654 CG1698-PA 73..654 56..629 1834 57.1 Plus
List-PD 564 CG15088-PD 3..559 42..600 1754 56.7 Plus