Clone BO27109 Report

Search the DGRC for BO27109

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptCG18858-RA
Protein status:BO27109.pep: Imported from assembly
Sequenced Size:1297

Clone Sequence Records

BO27109.complete Sequence

1297 bp assembled on 2010-09-17

GenBank Submission: KX795496

> BO27109.complete
GAAGTTATCAGTCGACATGAGGCTCAAATCGGGAGTGCTTTCGCTGCTCC
TGCTGACCACCTTCTTGGCCCTGGGCGAGTGCTTTTGGCCATTTAGCAAA
TGGCATGGAAGAAATGATAATCCTTCTGCCCCCCCTGAACCCAAGCTGTC
GCCAGTGATATTCGTACCCGGTGACGGAGGCTCCCAAATGGATGCTCGGC
TAAATAAGCCCAACTCTCCCTATTTAATTTGCCAAAAGACCCACGATTGG
TACAACCTGTGGCTGGATCTGGAGCAGTTGGTCATCCCCATGGTCTACTG
TTGGATAGACAATGTCAAGCTGTACTACGACAAGGTCACGAGGACCACCC
ACAACACTCCTGGTGTGGAGACGAGGATACCCGGCTGGGGCAATCCCGAG
GTGGTCGAGTGGATCGATCCCACCAAGAACAGCGCCGGAGCCTACTTCAA
GGATATAGCCAATGAGCTGGTGAAACTTGGATATATTCGCAAACAAAATA
TTCATGGAGCACCCTATGACTTCCGCAAAGCGCCAAATGAGAACCAACAG
TTCTTCATCGATCTCAAGCAGCTGGTGGAGGACTCCTATGAGGCCAACAA
TCAGTCGGCTGTGACCTTCATCTCGCACAGCATGGGCAGTCTCATGACCC
TGGTTTTCTTGCAGGAGCAAACCCTCCAATGGAAGGCGAAATACGTGAAG
CGCATGATCAGCCTGGCGGGAGTTTGGGCGGGAAGTTTTAAGGCTGTGAA
AGTGTTTGCCATGGGCGATGATCTCGACTCGTTCGCCCTGAGTGCCAAGA
TCCTCAAGGCGGAACAGATAACACACCCATCCACGGCCTGGTTGCTGCCC
TCGCCACTGTTTTGGAAGCCATCCGAGGTGCTCGCCATGACTCCAAGCAG
AAACTATACGATGGCACAGCTGGAAGAGTTCTTCAAAGACCTCGACTACA
TGACGGGCTGGGAAATGCGCAAGGACACGATTCGGTACAACCGAAACTTC
GATCCACCGAATGTGGAACTGCACTGTCTCTATGGCGAAGGCATCGACAC
GGTCGAGAGACTGCAGTACAAGAAATCGGACATTAGTGGGGAAACGCCCA
AGTTGATAATGGGTCTCGGCGACGGCACCGTTAACCAGCGTTCTCTGCGA
GCCTGCAAATATTGGGCGGGCTATTCTAAAGCGCCTATAAACACGCTCGC
TCTCCAGAACGTGGACCACTTGCACATCCTGTCCAATCCGGACGTCCTCA
AATATATCCGCACTGTCATGCAGCAGCCGGCAAGCTTTCTAGACCAT

BO27109.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG18858-RB 1266 CG18858-PB 1..1263 17..1279 6315 100 Plus
CG18858-RA 1266 CG18858-PA 1..1263 17..1279 6315 100 Plus
CG31683-RB 1266 CG31683-PB 1..1263 17..1279 6285 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG18858-RB 2029 CG18858-RB 431..1693 17..1279 6315 100 Plus
CG18858-RA 1817 CG18858-RA 431..1693 17..1279 6315 100 Plus
CG31683-RB 1823 CG31683-RB 437..1699 17..1279 6285 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20457468..20457994 1059..533 2620 99.8 Minus
2L 23513712 2L 20448351..20448873 1059..537 2600 99.8 Minus
2L 23513712 2L 20458054..20458431 541..164 1875 99.7 Minus
2L 23513712 2L 20448937..20449314 541..164 1860 99.5 Minus
2L 23513712 2L 20448066..20448287 1279..1058 1110 100 Minus
2L 23513712 2L 20457183..20457404 1279..1058 1110 100 Minus
2L 23513712 2L 20449381..20449528 164..17 740 100 Minus
2L 23513712 2L 20458498..20458645 164..17 740 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:42:45 has no hits.

BO27109.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-17 10:26:32 Download gff for BO27109.complete
Subject Subject Range Query Range Percent Splice Strand
CG18858-RA 438..1700 17..1281 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:27:29 Download gff for BO27109.complete
Subject Subject Range Query Range Percent Splice Strand
CG18858-RA 431..1693 17..1281 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:16:43 Download gff for BO27109.complete
Subject Subject Range Query Range Percent Splice Strand
CG18858-RA 431..1693 17..1281 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:16:43 Download gff for BO27109.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20458498..20458645 17..164 100   Minus
2L 20458059..20458430 165..536 100 <- Minus
2L 20457468..20457990 537..1059 100 <- Minus
2L 20457181..20457402 1060..1281 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:27:29 Download gff for BO27109.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20458498..20458645 17..164 100   Minus
arm_2L 20458059..20458430 165..536 100 <- Minus
arm_2L 20457468..20457990 537..1059 100 <- Minus
arm_2L 20457181..20457402 1060..1281 99 <- Minus

BO27109.pep Sequence

Translation from 16 to 1297

> BO27109.pep
MRLKSGVLSLLLLTTFLALGECFWPFSKWHGRNDNPSAPPEPKLSPVIFV
PGDGGSQMDARLNKPNSPYLICQKTHDWYNLWLDLEQLVIPMVYCWIDNV
KLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANE
LVKLGYIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVT
FISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMG
DDLDSFALSAKILKAEQITHPSTAWLLPSPLFWKPSEVLAMTPSRNYTMA
QLEEFFKDLDYMTGWEMRKDTIRYNRNFDPPNVELHCLYGEGIDTVERLQ
YKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVD
HLHILSNPDVLKYIRTVMQQPASFLDH

BO27109.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG18858-PB 421 CG18858-PB 1..421 1..421 2266 100 Plus
CG18858-PA 421 CG18858-PA 1..421 1..421 2266 100 Plus
CG31683-PB 421 CG31683-PB 1..421 1..421 2259 99.5 Plus
CG31683-PA 421 CG31683-PA 1..421 1..421 2259 99.5 Plus