Clone BO27118 Report

Search the DGRC for BO27118

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:18
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO27118.pep: Imported from assembly
Sequenced Size:1225

Clone Sequence Records

BO27118.complete Sequence

1225 bp assembled on 2010-09-17

> BO27118.complete
GAAGTTATCAGTCGACATGACCGTGACCGCCACACCGATGCCGGACAATC
TGCGGGTGAAAGCCTTATCCGAGTACCGAAAGAAGTTGCTAGAGCACAAG
GAAATCGAGGGACGCCTCAAAGAAAAGCGCGAGGAGATCAAGGATCTGAC
CAAGCTGTACGACAAGTCGGAGAACGATCTAAAGGCCCTGCAGAGCGTGG
GACAGATCGTTGGTGAGGTGCTGAAGCAGCTGACCGAGGATAAATTCATT
GTGAAGGCCACCAATGGACCCCGCTACGTGGTCGGCTGCCGCCGGCAGCT
GGACAAAGCCAAGCTGAAGTCCGGAACTCGTGTGGCCCTCGACATGACCA
CACTGACCATTATGCGCTACTTGCCGCGCGAGGTGGACCCACTGGTGTAC
AATATGTCGCACGAGGATCCCGGGGATGTCACCTACTCGGCCATCGGCGG
CCTAACCGACCAAATTCGCGAGCTGCGCGAAGTGATCGAGCTGCCCCTAC
TGAATCCGGAGCTCTTCCTGCGCGTCGGCATCACGCCACCGAAGGGTTGT
TTGCTGTACGGACCTCCTGGCACCGGCAAGACCCTGCTGGCCCGTGCAGT
GGCCTCCCAGCTGGACGCCAACTTCCTCAAGGTCGTGTCCTCGGCGATTG
TCGACAAGTATATTGGCGAGAGTGCGCGTCTCATTCGCGAGATGTTCAAC
TATGCCCGCGACCATCAGCCCTGCATCATTTTCATGGACGAAATCGACGC
TATCGGTGGTCGGCGCTTCTCCGAGGGCACCTCTGCCGATCGCGAGATCC
AGCGCACCCTGATGGAGCTGCTCAACCAGATGGACGGCTTCGATTCGCTT
GGCCAAGTCAAGATGATCATGGCAACCAATCGTCCGGACACCCTCGATCC
TGCCCTTCTGCGTCCGGGTCGCTTGGACAGGAAGATCGAGATTCCGCTGC
CCAACGAGCAGGCTAGGTTGGAAATTCTCAAGATTCACGCACTGAAGATC
GCCAAGCACGGCGAAATCGACTACGAGGCCATTGTCAAGCTGTCGGACAA
CTTTAATGGCGCTGATCTGCGTAATGTCTGCACGGAGGCGGGTCTCTTTG
CCATTCGTGCGGAGCGGGAGTACGTCATCCAGGAGGACTTCATGAAGGCG
GTGCGCAAGGTGTCGGACAACAAGAAGTTGGAGAGCAAGCTGGACTACAA
GCCCGTCGCAAGCTTTCTAGACCAT

BO27118.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt4-RB 1194 CG3455-PB 1..1191 17..1207 5955 100 Plus
Rpt4R-RB 1197 CG7257-PB 144..1190 157..1203 1665 77.3 Plus
Rpt4R-RA 1197 CG7257-PA 144..1190 157..1203 1665 77.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:49:33
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt4-RB 1465 CG3455-RB 123..1313 17..1207 5955 100 Plus
Rpt4R-RB 1502 CG7257-RB 336..1382 157..1203 1665 77.3 Plus
Rpt4R-RA 1391 CG7257-RA 225..1271 157..1203 1665 77.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6290053..6290775 968..246 3615 100 Minus
3L 28110227 3L 11942791..11943365 629..1203 910 77.2 Plus
3L 28110227 3L 11942247..11942724 157..634 785 77.6 Plus
X 23542271 X 6289785..6289928 1107..964 720 100 Minus
X 23542271 X 6290839..6290958 245..126 600 100 Minus
X 23542271 X 6291015..6291123 125..17 545 100 Minus
X 23542271 X 6289622..6289722 1207..1107 505 100 Minus
2R 25286936 2R 7652824..7653026 928..726 205 73.4 Minus
Blast to na_te.dros performed on 2014-11-28 05:49:31 has no hits.

BO27118.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-20 11:04:54 Download gff for BO27118.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt4-RA 121..1311 17..1209 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:28:16 Download gff for BO27118.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt4-RB 123..1313 17..1209 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:19:08 Download gff for BO27118.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt4-RB 123..1313 17..1209 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:19:08 Download gff for BO27118.complete
Subject Subject Range Query Range Percent Splice Strand
X 6291015..6291123 17..125 100   Minus
X 6290839..6290958 126..245 100 <- Minus
X 6290055..6290775 246..966 100 <- Minus
X 6289785..6289925 967..1107 100 <- Minus
X 6289620..6289721 1108..1209 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:28:16 Download gff for BO27118.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6185048..6185156 17..125 100   Minus
arm_X 6184872..6184991 126..245 100 <- Minus
arm_X 6184088..6184808 246..966 100 <- Minus
arm_X 6183818..6183958 967..1107 100 <- Minus
arm_X 6183653..6183754 1108..1209 98 <- Minus

BO27118.pep Sequence

Translation from 16 to 1225

> BO27118.pep
MTVTATPMPDNLRVKALSEYRKKLLEHKEIEGRLKEKREEIKDLTKLYDK
SENDLKALQSVGQIVGEVLKQLTEDKFIVKATNGPRYVVGCRRQLDKAKL
KSGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGDVTYSAIGGLTDQI
RELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLLARAVASQLD
ANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRR
FSEGTSADREIQRTLMELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRP
GRLDRKIEIPLPNEQARLEILKIHALKIAKHGEIDYEAIVKLSDNFNGAD
LRNVCTEAGLFAIRAEREYVIQEDFMKAVRKVSDNKKLESKLDYKPVASF
LDH

BO27118.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt4-PB 397 CG3455-PB 1..397 1..397 2011 100 Plus
Rpt4R-PB 398 CG7257-PB 6..398 5..397 1695 82.7 Plus
Rpt4R-PA 398 CG7257-PA 6..398 5..397 1695 82.7 Plus
Rpt1-PA 433 CG1341-PA 33..416 12..382 864 45 Plus
Rpt6-PA 405 CG1489-PA 24..389 14..382 862 48 Plus