Clone BO27119 Report

Search the DGRC for BO27119

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptCG14292-RA
Protein status:BO27119.pep: Imported from assembly
Sequenced Size:538

Clone Sequence Records

BO27119.complete Sequence

538 bp assembled on 2010-08-18

GenBank Submission: KX799875

> BO27119.complete
GAAGTTATCAGTCGACATGAAATTCGCAATTGTTCTACTGGCGGCCAGCA
TTGCCTGCATCAGTGCACAGGGCCCTGGAGCTACTGTTGGAAATCCCCTT
GCCGGAAATCCCTTTGCCGCCGCCAATCCGTATGCGGCTGCCTTTAATCC
CTTCCTAAATGGAATTTTCGGAGGTGCTGGCACAGGAGCTGCCGCCGGTG
TAGCCGCTCCCGTGGCACCGTCTGCTCCCTTTGGAGGCGCCTCGATTTCC
TCATTCTTCCAGTCGATAGTCCTGCAACGCGAAGCCGAGCGTCTGCTCTC
CCAGCCTGACTTTCCCGCCGACCTGGCGGAGCGCGTCCTGGATGTGGTGG
CCACCTCGGAGGAGTCGATCAGTGGCTGCAACAACGCCACTTTGCCCTGG
CTGCAGATACGCTGTGTCAAGCCTCTGCTGACCACGGCCAAGAACCAGCT
GAAGGCCATCGATGACGAGTGGCAGGCCCGTTTGGCCGCCACCGCCAGTC
CCACAGGAGCAGCTGCTGCCGCAAGCTTTCTAGACCAT

BO27119.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG14292-RA 507 CG14292-PA 1..504 17..520 2520 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG14292-RA 648 CG14292-RA 50..553 17..520 2520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18905028..18905479 520..69 2260 100 Minus
3R 32079331 3R 18905552..18905606 71..17 275 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:44:00 has no hits.

BO27119.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:34 Download gff for BO27119.complete
Subject Subject Range Query Range Percent Splice Strand
CG14292-RA 50..553 17..522 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:40 Download gff for BO27119.complete
Subject Subject Range Query Range Percent Splice Strand
CG14292-RA 50..553 17..522 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:19 Download gff for BO27119.complete
Subject Subject Range Query Range Percent Splice Strand
CG14292-RA 50..553 17..522 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:19 Download gff for BO27119.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18905553..18905606 17..70 100   Minus
3R 18905026..18905477 71..522 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:40 Download gff for BO27119.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14731275..14731328 17..70 100   Minus
arm_3R 14730748..14731199 71..522 99 <- Minus

BO27119.pep Sequence

Translation from 16 to 538

> BO27119.pep
MKFAIVLLAASIACISAQGPGATVGNPLAGNPFAAANPYAAAFNPFLNGI
FGGAGTGAAAGVAAPVAPSAPFGGASISSFFQSIVLQREAERLLSQPDFP
ADLAERVLDVVATSEESISGCNNATLPWLQIRCVKPLLTTAKNQLKAIDD
EWQARLAATASPTGAAAAASFLDH

BO27119.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG14292-PA 168 CG14292-PA 1..168 1..168 846 100 Plus