Clone BO27120 Report

Search the DGRC for BO27120

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptCG8786-RC
Protein status:BO27120.pep: Imported from assembly
Sequenced Size:1378

Clone Sequence Records

BO27120.complete Sequence

1378 bp assembled on 2010-09-17

GenBank Submission: KX797326

> BO27120.complete
GAAGTTATCAGTCGACATGTCGCAACAGCGCTCCACAGAGCAGATTGCAG
CTAGCAACAACAACACCAGCGATGTAATAGCGCTGGACGACGACGAGGAT
ACGGATGTGCAATTCGTTGCAGCTCTGCGTCCCACCGCACCAGTCATCGA
TCTTTGCGTCTCGCCCTCCACTTCTGCTGCTGCTGCTGCGGCGGCGGCAG
CTGCAGCCCACTCAGGAGGCGGAAGTGGCGAGGATCCGGCGGTTGGATCC
GCATCTGGAGCTGCTGCTTCGGATACCGATTCACTTGCTTCTTCGCCTGA
CGAAGGAGCGTTAGCCACCGGTGTGGATGCAGCGGCAGCCGTTTCTGGCG
AAGATTCCCCCTCTGCAGCGGCCGCTGCCTTGGAGTGTCCCATCTGTTTG
CAAACCTGCATCCACCCAGCTCGTCTCCCCTGTGGCCACATCTTCTGCTT
TTTGTGCGTGAAGGGTGTTGCTTATAAGAACCGCCGTTGTGCTATGTGCC
GTCGCGAGATTCCCGCCGAGTTCCTGGACCATCCCCAGCTGGTGAATGGC
ATTGAGGACATCTGCACCACTCGCGCGACCGAGGACGGCTTCCAGTGGTA
TTACGAGGGAAGAAACGGTTGGTGGCAGTACGATGACCGCACTAGTCAGG
ACATCGAAGATGCCTTTAAGAAGGGCGACAAATCCTGTACAATTTTGGTA
GCCGGCTACGTCTACATTGTGGACTTGGAGCAGCTAGTCCAGCAGCGCCA
GAATGAGCCCACTCGCTGCCGGAGGGTTAAGCGAGACCTAGCCACCATAC
CCAAAAAGGGGGTGGCCGGTCTGCGGATCGAAGGCAACCAGGTGACCAGC
GACACCGTCTTCAGCAGGCCAACCAACACAGCCAATCCAACCACCGTGGC
AGCAGCTGCCTCCAGTTTCATATCCACCATAGCAGCCACAGATGCGGCCA
TTAGAATCGCTAGCGACATAATAGGCTCAACGCTGGCTCATGCAGATGAA
CTAACTCGGGGACTGACGGCTAGCAATCTCAACGATGATCTCAGCAGCAG
CGGTGAGCAATCCAACTCCACAAATTCAAACGATGCAGGGCGCTCGCCTG
CCTCCTCGCCTGCCTCAAGTTCCATGCAGGATCTGATCACGCGTGACCTG
AGGAACACCCAACAGGTGATTGCCCACAACCAGCACACCATTGATCTCTT
CGAGCAGGCCTTGAACGACTTCCAGGCGCTGGCCATGCGCAACTATGTTG
ACTCCAGCGATGAGGAGAACAACGACCAGGATCAGGAGCATGAGCTGCGG
GAACGGGAGCAGCTGGAGGCGGGCGAGCAGCCACAGTCCAACGATAATCC
CCAGAGATTTGCAAGCTTTCTAGACCAT

BO27120.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG8786-RG 1347 CG8786-PG 1..1344 17..1360 6720 100 Plus
CG8786-RC 1347 CG8786-PC 1..1344 17..1360 6720 100 Plus
CG8786-RB 1131 CG8786-PB 1..1036 17..1052 5180 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8786-RG 3862 CG8786-RG 149..1493 16..1360 6725 100 Plus
CG8786-RC 1667 CG8786-RC 149..1493 16..1360 6725 100 Plus
CG8786-RB 1963 CG8786-RB 149..1185 16..1052 5185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19639576..19640319 1360..617 3720 100 Minus
3L 28110227 3L 19642352..19642668 332..16 1585 100 Minus
3L 28110227 3L 19641063..19641220 619..462 790 100 Minus
3L 28110227 3L 19641893..19642026 464..331 670 100 Minus
Blast to na_te.dros performed 2014-11-28 05:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2305..2467 340..175 112 53 Minus

BO27120.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-20 11:04:53 Download gff for BO27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG8786-RC 148..1491 17..1362 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:28:12 Download gff for BO27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG8786-RC 150..1493 17..1362 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:18:57 Download gff for BO27120.complete
Subject Subject Range Query Range Percent Splice Strand
CG8786-RC 150..1493 17..1362 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:18:57 Download gff for BO27120.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19642352..19642667 17..332 100   Minus
3L 19641894..19642024 333..463 100 <- Minus
3L 19641065..19641218 464..617 100 <- Minus
3L 19639574..19640318 618..1362 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:28:12 Download gff for BO27120.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19635452..19635767 17..332 100   Minus
arm_3L 19634994..19635124 333..463 100 <- Minus
arm_3L 19634165..19634318 464..617 100 <- Minus
arm_3L 19632674..19633418 618..1362 99 <- Minus

BO27120.pep Sequence

Translation from 16 to 1378

> BO27120.pep
MSQQRSTEQIAASNNNTSDVIALDDDEDTDVQFVAALRPTAPVIDLCVSP
STSAAAAAAAAAAAHSGGGSGEDPAVGSASGAAASDTDSLASSPDEGALA
TGVDAAAAVSGEDSPSAAAAALECPICLQTCIHPARLPCGHIFCFLCVKG
VAYKNRRCAMCRREIPAEFLDHPQLVNGIEDICTTRATEDGFQWYYEGRN
GWWQYDDRTSQDIEDAFKKGDKSCTILVAGYVYIVDLEQLVQQRQNEPTR
CRRVKRDLATIPKKGVAGLRIEGNQVTSDTVFSRPTNTANPTTVAAAASS
FISTIAATDAAIRIASDIIGSTLAHADELTRGLTASNLNDDLSSSGEQSN
STNSNDAGRSPASSPASSSMQDLITRDLRNTQQVIAHNQHTIDLFEQALN
DFQALAMRNYVDSSDEENNDQDQEHELREREQLEAGEQPQSNDNPQRFAS
FLDH

BO27120.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG8786-PG 448 CG8786-PG 1..448 1..448 2300 100 Plus
CG8786-PC 448 CG8786-PC 1..448 1..448 2300 100 Plus
CG8786-PB 376 CG8786-PB 1..352 1..352 1772 98.6 Plus
CG8786-PF 365 CG8786-PF 1..218 1..217 1096 96.8 Plus