Clone BO27121 Report

Search the DGRC for BO27121

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptCG42393-RA
Protein status:BO27121.pep: Imported from assembly
Sequenced Size:439

Clone Sequence Records

BO27121.complete Sequence

439 bp assembled on 2010-08-18

GenBank Submission: KX795205

> BO27121.complete
GAAGTTATCAGTCGACATGTGTAAATCGTGTGAGGAACAACCAGTTCGGT
GCTGCTCAATTTTCTATGCCGCTTTCTGCATTTCATGCGGTCTCTTCATG
CTCATTTTTTCGATTCACAATGTAATACTTTTGAAAAGCTCTATTACAGT
CGTGGATTTTTATTTGCATATGCATGGTGCTGACATGTCTCCCTCAACTT
TCCGCATCCTTTACTCGATGGATGTGATTTTTGCCCTTTCGTACGTCATT
GCTGGAACTTTACTAGCTGTTGGAATCCACCTGAACTCAAAGGGGGTCTT
CTTCGCTGGCAAGATCATAAGCTATTTCTTTCCAATATATAACATCCTTT
ATGTATTTCCTTTAATTGTGCACATTGCCGCCACAGTGAAATTATGCAGA
TATCTTAAAGAGAACTTTAATGCAAGCTTTCTAGACCAT

BO27121.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42393-RA 408 CG42393-PA 1..405 17..421 2025 100 Plus
CG32192-RC 402 CG32192-PC 283..396 305..418 225 79.8 Plus
CG32192-RB 411 CG32192-PB 292..405 305..418 225 79.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42393-RA 1142 CG42393-RA 112..516 17..421 2025 100 Plus
CG32192-RC 983 CG32192-RC 386..499 305..418 225 79.8 Plus
CG32192-RB 992 CG32192-RB 395..508 305..418 225 79.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18042844..18043110 17..283 1335 100 Plus
3L 28110227 3L 18043185..18043267 283..365 415 100 Plus
3L 28110227 3L 18043326..18043386 361..421 290 98.4 Plus
3L 28110227 3L 18040784..18040843 305..364 195 88.3 Plus
Blast to na_te.dros performed on 2014-11-28 02:43:55 has no hits.

BO27121.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:33 Download gff for BO27121.complete
Subject Subject Range Query Range Percent Splice Strand
CG42393-RA 112..516 17..423 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:38 Download gff for BO27121.complete
Subject Subject Range Query Range Percent Splice Strand
CG42393-RA 112..516 17..423 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:17 Download gff for BO27121.complete
Subject Subject Range Query Range Percent Splice Strand
CG42393-RA 112..516 17..423 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:17 Download gff for BO27121.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18043331..18043386 366..423 96   Plus
3L 18043186..18043267 284..365 100 -> Plus
3L 18042844..18043110 17..283 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:38 Download gff for BO27121.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18036431..18036486 366..423 96   Plus
arm_3L 18036286..18036367 284..365 100 -> Plus
arm_3L 18035944..18036210 17..283 100 -> Plus

BO27121.pep Sequence

Translation from 16 to 439

> BO27121.pep
MCKSCEEQPVRCCSIFYAAFCISCGLFMLIFSIHNVILLKSSITVVDFYL
HMHGADMSPSTFRILYSMDVIFALSYVIAGTLLAVGIHLNSKGVFFAGKI
ISYFFPIYNILYVFPLIVHIAATVKLCRYLKENFNASFLDH

BO27121.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42393-PA 135 CG42393-PA 1..135 1..135 707 100 Plus
CG32192-PB 136 CG32192-PB 3..136 2..135 472 61.2 Plus
CG32192-PC 133 CG32192-PC 3..133 2..135 455 60.4 Plus
CG44163-PA 118 CG44163-PA 8..117 12..134 174 36.6 Plus