Clone BO27124 Report

Search the DGRC for BO27124

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptCG13330-RA
Protein status:BO27124.pep: Imported from assembly
Sequenced Size:1867

Clone Sequence Records

BO27124.complete Sequence

1867 bp assembled on 2010-10-15

GenBank Submission: KX795631

> BO27124.complete
GAAGTTATCAGTCGACATGAATCGTATATCGAATCCTTCGCGTCGCCAGG
CGAGTGACGTCTTCATTGGTGACCCCTTCAAAATTCACTCATACAACTTT
CGCTATGCCGACAAGCCATTTTATCCGGTCCAGAACTATCAAAGACCTCC
GGCGGCACCGACTCCGCCGGCACTGGTGAAGAAGGCCTCCTTCCAGACCT
TCTACCACAATCCCAGATTCAGCCAGGATCCCGAGTACATTCCGGCAAAA
AAGAGTCCACAAACTAGCTCCTATAGGCGTCGCCTTTTGCTGGAATCTAT
GGATATGCCCTTGGGATCTACGGTGACAACGCCGGAGAGACAGAGTGTAC
CGGTGGCTCCGCAGACGAAGCGTTCTCCCACAGCCACGGATTCGCCGCTC
CTCAGGACATGCTGTCAAAGTGTGCGCTACGAGGCTATGAGACGGGGTCC
AAGCAACACGACTTTGTGCCAGAGTACCACGAATCTCATACGATCAGCTG
GCGGCGGTGTGCCTTCTACTTCAACCACCACCTTCTCCATGGACTCCAAC
GCCCATCTGCAGAACAGAAGAAGCGGCTGCGGTATCAGCATCGACATCTG
CAGTGTGGGTTCGCAATCTGAGGTGGACAACAATGTGAGCATCCAGATCG
CAACGGATGCCTATCTGCTGAACAATACGGACAAGGTGAGGACCAAGTCC
AAACCGGTGCGCTGTACGCCCAGATCCAGCGGCACCTTTGGCATCGACAA
GCGACTGTCCAAGTTCAATGTGAGCGAGACGAAACCTCGGACGAGTCCGG
AATGGGAGCTCCGGCAGAGAGAGAAGGCACGAGAAGCGGAGCGCCAACAA
AAACGGGAGCGGGATCGACAGTTGTTGGAGGACCGACGCTTGGAGCAGGA
GAGGGAACTTCAGGAGGAGCGAGAGCGTGCCCGCCAGCGGGAGCGAGATC
GTGAGCAGCTCCGCCAGTTGGAGCGCATGCGAGATGAGGAGCGACTCCTA
GAGTTGGAAGTGGAGCGCGAGAGGCAGCGATTGCGGGAACTAGAGCGGGA
AAACCAGCGGCACAGAGAATACGAGCGGCTGTGTGCCCTCCAGGAGCAGG
CGCGTCGGGAGCAAATGGATCTACTGTGCCAAGAGAACATACCTCCCCGA
CCGTCAGTTCCAATGACCTCGCACTTGTACACAACCACCTCTGATGATCG
TTTGCCCGGAATGGCCTTTTGTGATCTATCGTCCCGAAGGTCACGTCGAT
TGGAGAATCCGACCAGACCGAAAGAAAGACGGAAGACTAGAGTATGTCAG
GATCCTAGAAGTGTCTCGTCCGCTACCCGTTCACTTACTCCCCCGCCGAT
CCTTACCCGGAATAGCAGCTCCCCATCACCCTCTTCAGAAGCGCCGTCTT
CTACACCCACCTCCCGTTCCTCATCTCCAAATCGCAGGTCAAACCGCTGC
TTCAGTTCAACACCTAATCCCGATTCCCAACGATTCCCTCCTACAATTCC
AAGAGATCTAGTTCGCAGTAGTTCGGGAACTTCGAATGGCAATGTCCATG
TCACAGTGACCACCACCGGGCGACGGAGCAACTGCAGCATGAGGCGTTCA
TCCAATGACCGGGCTAGTGAGCAAAAGCAGCTAAATGGAAACCAAACCTG
CGTCGCCTGTCTGAATAATATGCCCATTAGGATAACCACATCTCGGTCCA
GGGATACGGATCTAGCCTTCAGTCTGAACCATGTGAGGATGAGGGGATCA
TCACCAGCGCCCACGGAAAGGAGCAGCAGTCAGGAAAGCCAAGATTCCTG
TCAGGTTAACATCAGCGTGTATGCGGATAAACTGCGTTTGATGCGTTTAG
CAAGCTTTCTAGACCAT

BO27124.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13330-RA 1836 CG13330-PA 1..1833 17..1849 9165 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG13330-RA 2129 CG13330-RA 78..1910 17..1849 9165 100 Plus
Vmat-RE 7325 CG33528-RE 3224..5040 1849..33 9085 100 Minus
Vmat-RF 7141 CG33528-RF 3040..4856 1849..33 9085 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13515417..13517233 33..1849 9085 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:06:32 has no hits.

BO27124.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:13 Download gff for BO27124.complete
Subject Subject Range Query Range Percent Splice Strand
CG13330-RA 78..1910 17..1851 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:02 Download gff for BO27124.complete
Subject Subject Range Query Range Percent Splice Strand
CG13330-RA 78..1910 17..1851 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:41 Download gff for BO27124.complete
Subject Subject Range Query Range Percent Splice Strand
CG13330-RA 78..1910 17..1851 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:41 Download gff for BO27124.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13515417..13517233 33..1851 99   Plus
2R 13515336..13515351 17..32 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:02 Download gff for BO27124.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9402922..9404738 33..1851 99   Plus
arm_2R 9402841..9402856 17..32 100 -> Plus

BO27124.pep Sequence

Translation from 16 to 1867

> BO27124.pep
MNRISNPSRRQASDVFIGDPFKIHSYNFRYADKPFYPVQNYQRPPAAPTP
PALVKKASFQTFYHNPRFSQDPEYIPAKKSPQTSSYRRRLLLESMDMPLG
STVTTPERQSVPVAPQTKRSPTATDSPLLRTCCQSVRYEAMRRGPSNTTL
CQSTTNLIRSAGGGVPSTSTTTFSMDSNAHLQNRRSGCGISIDICSVGSQ
SEVDNNVSIQIATDAYLLNNTDKVRTKSKPVRCTPRSSGTFGIDKRLSKF
NVSETKPRTSPEWELRQREKAREAERQQKRERDRQLLEDRRLEQERELQE
ERERARQRERDREQLRQLERMRDEERLLELEVERERQRLRELERENQRHR
EYERLCALQEQARREQMDLLCQENIPPRPSVPMTSHLYTTTSDDRLPGMA
FCDLSSRRSRRLENPTRPKERRKTRVCQDPRSVSSATRSLTPPPILTRNS
SSPSPSSEAPSSTPTSRSSSPNRRSNRCFSSTPNPDSQRFPPTIPRDLVR
SSSGTSNGNVHVTVTTTGRRSNCSMRRSSNDRASEQKQLNGNQTCVACLN
NMPIRITTSRSRDTDLAFSLNHVRMRGSSPAPTERSSSQESQDSCQVNIS
VYADKLRLMRLASFLDH

BO27124.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG13330-PA 611 CG13330-PA 1..611 1..611 3161 100 Plus
CG2839-PA 826 CG2839-PA 269..388 245..366 203 35.2 Plus
CG2839-PA 826 CG2839-PA 559..661 264..366 201 39.8 Plus
CG2839-PA 826 CG2839-PA 533..655 244..366 198 34.1 Plus
CG2839-PA 826 CG2839-PA 565..667 264..366 197 38.8 Plus
CG7971-PG 1062 CG7971-PG 491..792 253..594 197 25.4 Plus
CG7971-PA 1062 CG7971-PA 491..792 253..594 197 25.4 Plus
CG7971-PC 1107 CG7971-PC 491..792 253..594 197 25.4 Plus
CG2839-PA 826 CG2839-PA 310..410 264..366 196 41.3 Plus
CG2839-PA 826 CG2839-PA 577..679 264..366 193 37.9 Plus
CG2839-PA 826 CG2839-PA 583..685 264..366 193 37.9 Plus
CG7971-PG 1062 CG7971-PG 392..760 255..592 192 23.9 Plus
CG7971-PA 1062 CG7971-PA 392..760 255..592 192 23.9 Plus
CG2839-PA 826 CG2839-PA 571..673 264..366 191 36.9 Plus
CG2839-PA 826 CG2839-PA 595..697 264..366 186 35 Plus
CG2839-PA 826 CG2839-PA 601..703 264..366 186 35.9 Plus
CG2839-PA 826 CG2839-PA 316..416 264..366 184 36.9 Plus
CG2839-PA 826 CG2839-PA 589..691 264..366 184 35 Plus
CG2839-PA 826 CG2839-PA 274..399 243..366 183 34.9 Plus
CG2839-PA 826 CG2839-PA 531..631 264..366 182 38.8 Plus
CG2839-PA 826 CG2839-PA 613..715 264..366 181 34 Plus
CG2839-PA 826 CG2839-PA 304..404 264..366 180 35.9 Plus
CG2839-PA 826 CG2839-PA 485..625 244..366 177 33.3 Plus
CG2839-PA 826 CG2839-PA 607..708 264..365 174 32.4 Plus
CG2839-PA 826 CG2839-PA 474..589 258..366 170 37.3 Plus
CG2839-PA 826 CG2839-PA 643..750 264..371 169 29.6 Plus
CG2839-PA 826 CG2839-PA 444..554 253..366 168 33.3 Plus
CG2839-PA 826 CG2839-PA 615..721 258..366 168 32.1 Plus
CG2839-PA 826 CG2839-PA 631..733 264..366 167 30.1 Plus
CG2839-PA 826 CG2839-PA 637..748 264..373 167 33 Plus
CG2839-PA 826 CG2839-PA 625..727 264..366 166 30.1 Plus
CG2839-PA 826 CG2839-PA 328..427 264..366 165 34 Plus
CG2839-PA 826 CG2839-PA 352..466 264..366 161 38.3 Plus
CG2839-PA 826 CG2839-PA 346..455 264..373 159 33.3 Plus
CG2839-PA 826 CG2839-PA 318..421 258..366 158 32.1 Plus