Clone BO27127 Report

Search the DGRC for BO27127

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:27
Vector:pDNR-Dual
Associated Gene/TranscriptCG4653-RA
Protein status:BO27127.pep: Imported from assembly
Sequenced Size:796

Clone Sequence Records

BO27127.complete Sequence

796 bp assembled on 2010-09-17

GenBank Submission: KX799069

> BO27127.complete
GAAGTTATCAGTCGACATGAGTCCGGTTCAGTCATATTCACACAGTCGAC
TACTCCTGCTCGTGGTCATCGTGACCTTGGGCGTGGTCCAATCCAGTCGA
CTGCCGGCGGAGGTGGGCTCCCAGCCACACAGCATCTCACTGCGTCGGAA
TGGCGTCCATGTGTGCGGAGGAGCTTTGATCCGTGAAAAGTGGATCCTCA
CCGCAGCCCATTGCGTCAGTTTGGGCGGTGGACAGCAGAGCTACCCAGCT
AAATCCTACAATGTGCGAGTGGGCAGCATTCAGCGACTGACCGGTGGTCA
ACTGGTGCCTCTGTCCAAGATCATAATCCACACGAACTACTCCAGTTCGG
ATGCAGTTGGCTCTAATGACTTGGCCTTGCTGGAGCTGGAAACGTCGGTG
GTCCTGAATGCGAATACGAATCCGATTGATTTGGCCACCGAGCGACCGGC
GGCGGGCTCCCAGATTATCTTCTCCGGCTGGGGATCCAGCCAGGTGGACG
GATCTCTCAGTCATGTCCTCCAGGTGGCCACCAGACAGAGCCTGAGTGCG
TCCGATTGCCAAACGGAGCTGTACCTGCAGCAGGAGGATCTGCTCTGTTT
GTCCCCGGTGGACGAGGACTTCGCCGGACTCTGTTCCGGTGATGCCGGAG
CTCCGGCGTCTTACAACAACCAATTGGTGGGCATTGCCGCCTTCTTTGTG
AGCGGATGTGGTTCCGAGCAGCCCGATGGCTACGTGGATGTGACCCAGCA
TCTGGAGTGGATTAACGAAAACGCTGTTGCAAGCTTTCTAGACCAT

BO27127.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG4653-RA 765 CG4653-PA 1..762 17..778 3810 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG4653-RA 895 CG4653-RA 7..769 16..778 3815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16704613..16705152 239..778 2700 100 Plus
X 23542271 X 16704087..16704311 16..240 1125 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:46:02 has no hits.

BO27127.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-20 11:04:49 Download gff for BO27127.complete
Subject Subject Range Query Range Percent Splice Strand
CG4653-RA 1..762 17..780 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:27:57 Download gff for BO27127.complete
Subject Subject Range Query Range Percent Splice Strand
CG4653-RA 8..769 17..780 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:17:52 Download gff for BO27127.complete
Subject Subject Range Query Range Percent Splice Strand
CG4653-RA 8..769 17..780 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:17:52 Download gff for BO27127.complete
Subject Subject Range Query Range Percent Splice Strand
X 16704615..16705152 241..780 99   Plus
X 16704088..16704311 17..240 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:27:57 Download gff for BO27127.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16598648..16599185 241..780 99   Plus
arm_X 16598121..16598344 17..240 100 -> Plus

BO27127.pep Sequence

Translation from 16 to 796

> BO27127.pep
MSPVQSYSHSRLLLLVVIVTLGVVQSSRLPAEVGSQPHSISLRRNGVHVC
GGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLS
KIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQI
IFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQEDLLCLSPVDE
DFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWIN
ENAVASFLDH

BO27127.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG4653-PA 254 CG4653-PA 1..254 1..254 1295 100 Plus
CG1304-PA 260 CG1304-PA 44..257 37..253 433 40.9 Plus
Ser6-PA 259 CG2071-PA 44..257 37..253 422 41.2 Plus
CG9676-PA 251 CG9676-PA 34..249 31..253 413 40.3 Plus
CG32523-PA 262 CG32523-PA 41..260 29..253 368 36.1 Plus