Clone BO27129 Report

Search the DGRC for BO27129

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:29
Vector:pDNR-Dual
Associated Gene/TranscriptCG42361-RA
Protein status:BO27129.pep: Imported from assembly
Sequenced Size:655

Clone Sequence Records

BO27129.complete Sequence

655 bp assembled on 2010-08-18

GenBank Submission: KX797782

> BO27129.complete
GAAGTTATCAGTCGACATGGAGAAGATCTGGAAGAAGGTGTGCGAGCACC
ACGATGTGCCCGAGCAGGTGGCCAACGAGTGGTTCGCCCGCATTCAGCAG
CACCTGAGCTCCGAGGATCCCGCTCGCGCCTACCACAATTGGGAGGAGAT
GATGCGGCGCAAGGAGCCGCACTTGGCGGGCGTGGCCAATCCCAACATTG
TGCTGGCCGCCTTCTTCCAGTACTACCACTTCGATGGTAACCGCAGCTGT
GCGGAGAAGAACTGCGAGGTCTTTGAGGAGTTTTGCAATGATGCCGTCAT
CGAGGATGACCATGCAAAAAGCCTGGTATGTAATTTGCTGGGGCGCAAGA
CCCCGGAGAACCAGTTGACCTGGTGCCATGACGACGAGGCCAACTTGCTG
CAGGACGTAGACCTGGTGGTCCTAGCTGCTTCGCCGGAGGAGTACAAGCA
CTATACAACTCTCCTTCGCTCGGAGTACGCCAATCTCGACGATGCCACCT
ACAAGGCCATGCGCATCAAGGTGCTGGAGACCCTGCTGATGATTCCCTCC
ATCTACGCCACTGGAGACTACCACGACAAGTACGAAGAGCTAGCCCGCGC
CAACATACGCAACGAGATCAGCGAGCTGAAGAAGCAGGCAAGCTTTCTAG
ACCAT

BO27129.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG42361-RA 624 CG42361-PA 1..621 17..637 3105 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG42361-RA 1001 CG42361-RA 122..742 17..637 3105 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:43:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24607794..24608085 17..308 1460 100 Plus
2R 25286936 2R 24608319..24608529 427..637 1055 100 Plus
2R 25286936 2R 24608143..24608261 308..426 595 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:43:44 has no hits.

BO27129.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:30 Download gff for BO27129.complete
Subject Subject Range Query Range Percent Splice Strand
CG42361-RA 102..722 17..639 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:35 Download gff for BO27129.complete
Subject Subject Range Query Range Percent Splice Strand
CG42361-RA 122..742 17..639 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:13 Download gff for BO27129.complete
Subject Subject Range Query Range Percent Splice Strand
CG42361-RA 122..742 17..639 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:13 Download gff for BO27129.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24608319..24608529 427..639 99   Plus
2R 24608143..24608261 308..426 100 -> Plus
2R 24607794..24608084 17..307 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:35 Download gff for BO27129.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20495842..20496052 427..639 99   Plus
arm_2R 20495666..20495784 308..426 100 -> Plus
arm_2R 20495317..20495607 17..307 100 -> Plus

BO27129.pep Sequence

Translation from 16 to 655

> BO27129.pep
MEKIWKKVCEHHDVPEQVANEWFARIQQHLSSEDPARAYHNWEEMMRRKE
PHLAGVANPNIVLAAFFQYYHFDGNRSCAEKNCEVFEEFCNDAVIEDDHA
KSLVCNLLGRKTPENQLTWCHDDEANLLQDVDLVVLAASPEEYKHYTTLL
RSEYANLDDATYKAMRIKVLETLLMIPSIYATGDYHDKYEELARANIRNE
ISELKKQASFLDH

BO27129.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42361-PA 207 CG3579-PA 1..207 1..207 1116 100 Plus