Clone BO27131 Report

Search the DGRC for BO27131

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptSpn77Bb-RA
Protein status:BO27131.pep: Imported from assembly
Sequenced Size:1120

Clone Sequence Records

BO27131.complete Sequence

1120 bp assembled on 2010-09-17

GenBank Submission: KX799793

> BO27131.complete
GAAGTTATCAGTCGACATGAAGCTCGGATTTCTGGGGCTTTTTGGCATGG
TGCTCATGATCATGTTCTACGAGGGAGCAGAAGGGTATACCGTCAATGAG
CTGCGCGATGTCCTGGGGATCTATGTCGATTATCCAACACTGCGCAGGTG
GTACGAGGATGTCCGAGCTTATCACTATTTAAATTCGGAAAACACAAAAC
TGTTTTCGCTGCGTTACGCTTACTACGACGACGTAGGAGATTTAGAACTC
GTGAAAGGGTACAACAGTGTAGTCCTAGAAGGAGTAGGAGAAGGAAATGT
GGTTCTTCGAGAGGGTCGGCCAAGGGGTGTGGACTTCGACCAGGGGGCGA
GTATAATAATCAACGACGATATCGACAAAGCCTCTCATGCGAAAATCTTC
AGTTCTTATAGCCGTCGTTCGTTCAATAGTACAGTAACTGTGCTGGGGAT
TACTGTTAGCTACTTTAAGGCCAAATGGAAGTATCCATTCGATAAGTCCC
AGACGAAAGTGGAACAGTTTTACAACGACGGCGGCTCGCCGGCAGGTAAG
GTGGAGATGATGGTGCAAACGGGGAAGTATGCCTACGTCAATAATGTAAA
GGGTCTGCAAGCGGATGTCCTGGAGCTACCTTTTGGGGAACATGAGCTAG
TAATGATCGTCTTACTGCCGAAGTCATCCCAGGGAGTTAACCTGGTGCTC
TACCAATTGAAGAACCTGGGACTACATCGCCTCCTTGAGAAACTCGAGGC
CTCCAAGAATGAAACTGATGTAGAAGTCAAGCTTCCCAAGTTCGATACGC
GATCCGTACTTTCACTCGAAGATACCGTATATGACGCTGGACTAACGGAT
CTGAGGAACGACTTCGCAGATCTAGATAAATTGCTGATTGCTATCGGTCA
CAGAGGTGCGTGCCTCACCCTCTACCACCAATTCGCCAGGATCGTCGTAG
ATGAAGAGGGTTTGCCTAATGCTGTTCCGCAGAAGTCTTCTGGAAAAAAT
AACATCAAGTTCCATGTAAACAGGCCGTTTGCATACCTTGTCCTACAAAA
GAAACACAAATTGCTCATTCACTCCGGAGTCTTTCGGGAAGGTGAGATCC
AGGCAAGCTTTCTAGACCAT

BO27131.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Spn77Bb-RA 1089 CG6663-PA 1..1086 17..1102 5430 100 Plus
Spn77Bc-RB 1251 CG6289-PB 202..1248 56..1102 4545 95.6 Plus
Spn77Bc-RA 1251 CG6289-PA 202..1248 56..1102 4545 95.6 Plus
Spn77Bc-RB 1251 CG6289-PB 1..40 17..56 185 97.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
Spn77Bb-RA 1161 CG6663-RA 35..1120 17..1102 5430 100 Plus
Spn77Bc-RB 1430 CG6289-RB 241..1287 56..1102 4545 95.6 Plus
Spn77Bc-RA 1440 CG6289-RA 251..1297 56..1102 4545 95.6 Plus
Spn77Bc-RB 1430 CG6289-RB 40..79 17..56 185 97.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20321638..20321994 480..836 1785 100 Plus
3L 28110227 3L 20343497..20343851 480..834 1610 96.9 Plus
3L 28110227 3L 20321269..20321572 178..481 1520 100 Plus
3L 28110227 3L 20343128..20343431 178..481 1490 99.3 Plus
3L 28110227 3L 20322051..20322317 836..1102 1335 100 Plus
3L 28110227 3L 20343910..20344176 836..1102 1020 92.1 Plus
3L 28110227 3L 20321041..20321201 17..177 805 100 Plus
3L 28110227 3L 20342939..20343060 56..177 445 91 Plus
3L 28110227 3L 20342738..20342777 17..56 185 97.5 Plus
Blast to na_te.dros performed on 2014-11-28 05:44:59 has no hits.

BO27131.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-20 11:04:48 Download gff for BO27131.complete
Subject Subject Range Query Range Percent Splice Strand
CG6663-RA 25..1110 17..1104 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:27:52 Download gff for BO27131.complete
Subject Subject Range Query Range Percent Splice Strand
Spn77Bb-RA 35..1120 17..1104 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:17:32 Download gff for BO27131.complete
Subject Subject Range Query Range Percent Splice Strand
Spn77Bb-RA 35..1120 17..1104 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:17:32 Download gff for BO27131.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20322051..20322317 836..1104 99   Plus
3L 20321640..20321993 482..835 100 -> Plus
3L 20321269..20321572 178..481 100 -> Plus
3L 20321041..20321201 17..177 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:27:52 Download gff for BO27131.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20315151..20315417 836..1104 99   Plus
arm_3L 20314740..20315093 482..835 100 -> Plus
arm_3L 20314369..20314672 178..481 100 -> Plus
arm_3L 20314141..20314301 17..177 100 -> Plus

BO27131.pep Sequence

Translation from 16 to 1120

> BO27131.pep
MKLGFLGLFGMVLMIMFYEGAEGYTVNELRDVLGIYVDYPTLRRWYEDVR
AYHYLNSENTKLFSLRYAYYDDVGDLELVKGYNSVVLEGVGEGNVVLREG
RPRGVDFDQGASIIINDDIDKASHAKIFSSYSRRSFNSTVTVLGITVSYF
KAKWKYPFDKSQTKVEQFYNDGGSPAGKVEMMVQTGKYAYVNNVKGLQAD
VLELPFGEHELVMIVLLPKSSQGVNLVLYQLKNLGLHRLLEKLEASKNET
DVEVKLPKFDTRSVLSLEDTVYDAGLTDLRNDFADLDKLLIAIGHRGACL
TLYHQFARIVVDEEGLPNAVPQKSSGKNNIKFHVNRPFAYLVLQKKHKLL
IHSGVFREGEIQASFLDH

BO27131.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:31:45
Subject Length Description Subject Range Query Range Score Percent Strand
Spn77Bb-PA 362 CG6663-PA 1..362 1..362 1869 100 Plus
Spn77Bc-PB 416 CG6289-PB 67..416 13..362 1664 92 Plus
Spn77Bc-PA 416 CG6289-PA 67..416 13..362 1664 92 Plus
Spn77Ba-PC 450 CG6680-PC 108..445 13..357 407 32.4 Plus
Spn77Ba-PB 450 CG6680-PB 108..445 13..357 407 32.4 Plus