Clone BO27133 Report

Search the DGRC for BO27133

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:33
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO27133.pep: Imported from assembly
Sequenced Size:2545

Clone Sequence Records

BO27133.complete Sequence

2545 bp assembled on 2010-10-15

> BO27133.complete
GAAGTTATCAGTCGACATGTTTTCTTACTGGACCAAACAGAATATATCAA
GCTCAGTAGATGGAAAAAAGATGGACAAAGTTTCTACCATGAGAAAAAAA
AATTCAACAAAAGTTAAAATGGAGAAAAAAGAAACAGTTGTACCGATTAC
AGAAATGCGTGCTCTGGAATTTCAAGATTTCCTTAAGCGGGTACAGACGT
TACAAATGTCGCACAACGAAAGCCGCGATTTAGTCAATGGACCTAATATC
TGCAGTTCCATGGATATTGAAGTCGGCGAAGAACCTCCTACGACATCTTT
TGCCGATAACATAGATAAAGCGTGTCCTTTACCAGTGCTGCGATCATCTG
ATTGTGATTGTGTGCCACTTTGTATGACAAATATTCGTGTATCAGTTGGT
ATTGACAAAGACTTAGAAATGATTCTTGAAATGGATCCGAGTATTGTAGA
TTTGGGTGATATTAGCATTGATGAAACTGCAGAACCGCGCATAGTGGGCT
TACCTCCACTTTCGGGTGGACCGACATTTAAAACTGCTACTCCCACTTCA
CGAACACAACTAAAACTGCAGCTACAACGTGAACAACAGCAACAAATGAT
GATACAACAACAGACATTAGACACTGCTATGGACCCAAAAATGCATCTAT
TGTTTGGCAGTGGGCAGGGGCTTATGGAATCGGAATTCATTGACAGCGGT
AGTACCAGTGCTTGTGGCAGCGGGTCATCCAGTTTAGAACAAATGTCACA
GTTAGTGCAAATGGACAATTTAATTGATTCGTCAAGTGGAGCCAAGCTTA
AAGTTCCTCTTCAAAGTATCGGAGTAGATGTGCCACCCCAAGTGCTGCAG
GTCAGTACAGTGCTTGAAAACCCTACAAGGTATCACGTTATCCAAAAGCA
AAAGAATCAAGTGAGGCAATATCTCAGCGAATCCTTTAAGCCGTCTATGT
GGGGCAGTCATACCAGCGAAATAAAATTAGCAAATAATTCTGCGTCAACG
GGAAATCTTCAAAATTCATCTTTACAGAAAGGTATTTGCGATCCATTGGA
GCGTACAAACCGATTTGGATGCGATTCGGCTGTGAGTGCTAAAAGAATTA
TGCCTTCCGATGACGCAATGCCTATTTCCCCATTCGGTGGTAGTTTTGTA
CGATGTGATGACATAAATCCAATTGAGCCAACTGTATTACGACCTAATAG
TCATGGTGCTGGGGAACCAGAAAATGCACATAGAACGGCCCAGTTGGGAC
TTAGTAAAGCTAATTCAAGCCTAAGTTCAACGCGTTCTTCTTCAGGGATT
GTTAATTCAATTCGAATTTCCAGTACATCAAGCTCGTTACAGTCTACCTC
AGCTCCTATTTCGCCGAGCGTAAGTTCGGTTGCAACGAGTGTCTCTGAGC
CAGATGACATCTTCGATGATATATTACAAAATGACTCTTTTAACTTTGAT
AAAAACTTCAACTCTGAGCTTTCAATTAAACAGGAACCTCAAAATTTAAC
TGATGCTGAAATGAATGCCCTAGCCAAGGACAGACAAAAGAAAGACAACC
ATAATATGATTGAGCGAAGGCGACGCTTTAATATAAATGACAGAATAAAA
GAGCTTGGTACCCTTTTGCCAAAGGGCAGTGATGCTTTTTACGAAGTAGT
TCGAGACATTCGTCCAAACAAGGGGACAATCTTGAAGTCCTCTGTTGACT
ACATTAAATGCTTGAAACATGAGGTGACTCGCTTAAGACAAAATGAGTTA
CGTCAACGTCAAGTAGAGTTGCAAAATCGAAAGCTCATGTCTCGAATAAA
AGAATTGGAAATGCAGGCCAAGTCCCATGGAATTTTGTTATCAGAAAACC
ACCTAACATCACTATCAGCGCCTACTCAACCTTATCTTAAAAGTTTTAGC
CTGTCTCCTACTGCTTCTCGGAGTCGTCGATCACTTTTTGACCAACCTGT
TGAAAAAAAAATACAAGTTATTGATGGTGCCGATGGAAATATGGGAATGA
ATCAGGTTGATGAGTTTATGGAAGATTGCAAGTATGCAGTACAAGGCGGC
GATCCGATGTTGTCCTCGCATAGTCACATGCAATCCGCGCCACAATCACC
GAGTTCAAAAACTTTGAATAGTGGAAGTTTTGAACCAAAGAATTTTTCGG
AGGCTGATGAAAGCCTTTTTAGAGGCAAATCAAGTTTAGCATCAGATGAC
TGTTGCGGTATAAATTGCAGTACTTCGTGCTATATTCAACACCAATTGAC
TTCGCGTGAGGGCCATCCAAATCATTCTCACCACACGGGTATACGAGAAA
TTCATAGTTTGTCTGATTCGGCTCAAAACTCAGAGTTTAGTAGGCTTGAG
CATTGCGATGATCCACTTCTCTCATCTTCCCATAGGTCACTTGGCACCGT
AGACGAAGATCAACATAATTCAGTTGATATGTCTGCAGTCATGGTACACG
ACTCCCTATCCTCTTTGGTAGATGACAACAATAGCGAAACAATGGTTCTT
GCATCTGACACATTGGATATTGAGTTAGCAAGCTTTCTAGACCAT

BO27133.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
Mitf-RC 2514 CG43369-PC 1..2511 17..2527 12555 100 Plus
Mitf-RB 2193 CG43369-PB 162..2190 520..2527 9795 99 Plus
Mitf-RA 2193 CG43369-PA 162..2190 520..2527 9795 99 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
Mitf-RC 3226 CG43369-RC 54..2564 17..2527 12555 100 Plus
Mitf-RB 3009 CG43369-RB 319..2347 520..2527 9795 99 Plus
Mitf-RA 4032 CG43369-RA 325..2353 520..2527 9795 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 1222218..1222788 1957..2527 2840 99.8 Plus
4 1348131 4 1219093..1219595 17..519 2515 100 Plus
4 1348131 4 1220260..1220688 971..1399 2145 100 Plus
4 1348131 4 1219693..1220026 519..852 1670 100 Plus
4 1348131 4 1221708..1221950 1560..1802 1215 100 Plus
4 1348131 4 1221489..1221650 1398..1559 810 100 Plus
4 1348131 4 1222006..1222164 1802..1960 795 100 Plus
4 1348131 4 1220073..1220199 848..974 620 99.2 Plus
Blast to na_te.dros performed 2014-11-26 15:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6765..6847 532..613 151 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6814 520..613 130 61.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2468..2531 556..620 124 67.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2420..2476 550..612 121 71.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2342..2425 530..612 120 61.9 Plus

BO27133.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:13 Download gff for BO27133.complete
Subject Subject Range Query Range Percent Splice Strand
Mitf-RB 1214..2347 1395..2529 99   Plus
Mitf-RB 319..1193 520..1394 100 <- Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:59 Download gff for BO27133.complete
Subject Subject Range Query Range Percent Splice Strand
Mitf-RC 61..2564 24..2529 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:38 Download gff for BO27133.complete
Subject Subject Range Query Range Percent Splice Strand
Mitf-RC 61..2564 24..2529 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:38 Download gff for BO27133.complete
Subject Subject Range Query Range Percent Splice Strand
4 1222222..1222788 1961..2529 99   Plus
4 1222006..1222164 1802..1960 100 -> Plus
4 1221708..1221949 1560..1801 100 -> Plus
4 1221491..1221650 1400..1559 100 -> Plus
4 1220260..1220688 971..1399 100 -> Plus
4 1220076..1220195 851..970 100 -> Plus
4 1219694..1220024 520..850 100 -> Plus
4 1219100..1219595 24..519 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:59 Download gff for BO27133.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 1225948..1226514 1961..2529 99   Plus
arm_4 1225732..1225890 1802..1960 100 -> Plus
arm_4 1225434..1225675 1560..1801 100 -> Plus
arm_4 1225217..1225376 1400..1559 100 -> Plus
arm_4 1223986..1224414 971..1399 100 -> Plus
arm_4 1223802..1223921 851..970 100 -> Plus
arm_4 1223420..1223750 520..850 100 -> Plus
arm_4 1222826..1223321 24..519 100 -> Plus

BO27133.pep Sequence

Translation from 16 to 2545

> BO27133.pep
MFSYWTKQNISSSVDGKKMDKVSTMRKKNSTKVKMEKKETVVPITEMRAL
EFQDFLKRVQTLQMSHNESRDLVNGPNICSSMDIEVGEEPPTTSFADNID
KACPLPVLRSSDCDCVPLCMTNIRVSVGIDKDLEMILEMDPSIVDLGDIS
IDETAEPRIVGLPPLSGGPTFKTATPTSRTQLKLQLQREQQQQMMIQQQT
LDTAMDPKMHLLFGSGQGLMESEFIDSGSTSACGSGSSSLEQMSQLVQMD
NLIDSSSGAKLKVPLQSIGVDVPPQVLQVSTVLENPTRYHVIQKQKNQVR
QYLSESFKPSMWGSHTSEIKLANNSASTGNLQNSSLQKGICDPLERTNRF
GCDSAVSAKRIMPSDDAMPISPFGGSFVRCDDINPIEPTVLRPNSHGAGE
PENAHRTAQLGLSKANSSLSSTRSSSGIVNSIRISSTSSSLQSTSAPISP
SVSSVATSVSEPDDIFDDILQNDSFNFDKNFNSELSIKQEPQNLTDAEMN
ALAKDRQKKDNHNMIERRRRFNINDRIKELGTLLPKGSDAFYEVVRDIRP
NKGTILKSSVDYIKCLKHEVTRLRQNELRQRQVELQNRKLMSRIKELEMQ
AKSHGILLSENHLTSLSAPTQPYLKSFSLSPTASRSRRSLFDQPVEKKIQ
VIDGADGNMGMNQVDEFMEDCKYAVQGGDPMLSSHSHMQSAPQSPSSKTL
NSGSFEPKNFSEADESLFRGKSSLASDDCCGINCSTSCYIQHQLTSREGH
PNHSHHTGIREIHSLSDSAQNSEFSRLEHCDDPLLSSSHRSLGTVDEDQH
NSVDMSAVMVHDSLSSLVDDNNSETMVLASDTLDIELASFLDH

BO27133.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
Mitf-PC 837 CG43369-PC 1..837 1..837 4281 100 Plus
Mitf-PB 730 CG17469-PB 55..730 169..837 3395 99 Plus
Mitf-PA 730 CG17469-PA 55..730 169..837 3395 99 Plus
Mitf-PD 704 CG43369-PD 55..704 169..837 3293 97.2 Plus